KEGG   Capsicum annuum: 107850337Help
Entry
107850337         CDS       T04646                                 

Definition
(RefSeq) SWI/SNF complex subunit SWI3D
  KO
K11649  SWI/SNF related-matrix-associated actin-dependent regulator of chromatin subfamily C
Organism
cann  Capsicum annuum
Brite
KEGG Orthology (KO) [BR:cann00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:cann03021]
    107850337
   03036 Chromosome and associated proteins [BR:cann03036]
    107850337
Transcription machinery [BR:cann03021]
 Eukaryotic type
  RNA polymerase II system
   Coactivators
    BAF/PBAF complex
     107850337
Chromosome and associated proteins [BR:cann03036]
 Eukaryotic type
  Chromatin remodeling factors
   BAF complex
    107850337
   PBAF complex
    107850337
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SWIRM-assoc_1 SWIRM Myb_DNA-binding ZZ Myb_DNA-bind_6 C1_2
Motif
Other DBs
NCBI-GeneID: 107850337
NCBI-ProteinID: XP_016550276
UniProt: A0A1U8EV60
LinkDB All DBs
Position
12
AA seq 944 aa AA seqDB search
MEEKRKDTGTPPPPSADTPPISADAPSVEPPTSRRRGGGHKRKASAIGSGASSTPPSTLS
KRQKQSAVPFPPIHNGPLTRARQQPNHAAAAAAAAAGSPSGFGFTIESEVFPKAEAGVEE
AVRVEKESNQVKEDLEALEAEIEAEIESIGSRDRNVHIVPTHAGWFSWTKVHPLEKRTMP
SFFNEKLQSRTPEIYMQIRNWIMKKYHTNPNIQIELNDLSELSAGDLDVKQEVMEFLDYW
GLINYHPFPQTNSVMNVDIDGDKAARTDSLIDKLFRFESDETWTPVLPRSSVATPSVSSG
FFPESAIAEELKSEGPAVEYHCNSCSADCSRKRYHCQKEADFDLCSECFNNGKFGSGMSP
SDFIVMEPGEVGSASGGKWTDQETLLLLEALELYKENWNEIAEHVATKTKAQCILHFIEM
PIEDRFLDTDAESNKLVKEKEDAVLSKDDTSASKDAPETTETKDDGNDDQLSSTVETSKP
ENVNGPIPQEEVGENCALNALRDAFTAVDFYPPPGERASFAEAGNPVMALAAFLVKLVEA
KKVSASVRSSLKSISGNPSGEQLALRHCFILEDPPDDGKTSSDSDRPANGSVDPEHKKDE
DDNVEMQEEKLTSVIDEKSLSVGQDKETKGETNIDKKCEERDGENHEEKNEKELEVATHL
VSTSDKSQEKSDTSKQSGAISTDKEGESASLKKPDDAGLAVGQTPSTTAESNVLTSKLEV
PPGFEKESVDEASMAIPSNSPDTPKDEDMMPAVQTKEPEQSMKSNIVLENGKNTGTVEVK
DSVDGRKDPLKIKNDLDIDKIKRAAVTALSAAAVKAKYLADQEEDQIRLLTTALIEKQLH
KLESKITFFHDMDNVVMRVRELLERSKQRLVSERQQIINARRAGPQPVLANRPGMTLANS
APRLPTAMSSPRIPNSRPIMAGAPTPSSFMPTTVSGNSMQPSNR
NT seq 2835 nt NT seq  +upstreamnt  +downstreamnt
atggaggagaaacggaaggacaccggaactccaccaccgccgtccgccgacacgccgccg
atatcggctgacgctccgtcagttgaaccacctacgtcgcgtcggagaggtggcggccac
aaacgaaaagcaagcgccattgggagtggcgctagttctactcctccctcaactttatcg
aagcgtcagaaacaatcagcagtacctttcccaccgatccacaatggtccgctcacaaga
gctcggcagcagccaaaccacgccgcagctgccgccgccgccgcagctggttctccgtca
ggttttggttttacgatcgaatcggaggtgtttccgaaggccgaggcaggtgtagaagag
gcggtgagagttgagaaagagtcgaatcaagtgaaggaggatttggaggcattagaggct
gaaattgaagctgaaattgagtcaattggatcccgagatcgtaatgttcatattgtgcct
actcatgcaggttggttctcttggacgaaggttcatcctttggagaagcgaacaatgcca
tcattcttcaatgagaagttgcaaagtaggactccagaaatatacatgcagatacggaat
tggatcatgaaaaagtatcacactaaccccaatattcaaattgagttaaatgatttgtcc
gagctctcagcaggagatttggacgttaaacaggaagtgatggagtttttggactactgg
ggtttaattaattatcaccctttcccacaaaccaattcagttatgaacgttgatattgat
ggggacaaggcagcaaggacagattctttgattgataaactgtttcgattcgaatcagat
gaaacgtggaccccagttcttccaaggtctagtgtagctactccttctgtgtcttctggg
ttctttccagagtcagcaattgctgaagaactaaagtccgaagggccagctgttgagtac
cattgcaactcttgctcagctgactgctcgagaaagcggtatcattgccaaaaggaggca
gattttgacttgtgtagtgaatgcttcaataatgggaagtttggatctgggatgtcccct
tcagatttcattgttatggagcctggtgaggttggcagtgcaagtggtggaaagtggaca
gatcaggagactcttcttctccttgaggcattagagctgtataaggaaaattggaatgag
attgcggagcatgtggctacaaagactaaagctcagtgtattctgcatttcattgaaatg
ccaatagaggataggttcctggatactgatgctgaaagtaacaagcttgttaaagaaaaa
gaagatgcagttttgtctaaagatgatacatcagccagtaaagatgccccagaaacaaca
gaaaccaaggatgatggaaatgacgatcagctttcatccacagtggaaacatcgaaacca
gagaatgttaatgggccaattcctcaggaggaagttggtgagaactgtgcactcaatgca
ctgagggacgcatttacagctgttgatttttatcctccacctggcgaacgtgcttcattt
gctgaagctggcaatcctgtaatggcattggcagcattcctggtgaaactggtagaagct
aaaaaggtttctgcctcagtgcgcagctctttgaaatccatttctggtaatccttctggt
gagcagctagccttaaggcactgttttattttggaagatccaccagatgatgggaagaca
tcatctgattcagatagacctgctaatggatcagttgatccagagcataagaaagatgag
gatgacaatgttgaaatgcaggaggaaaagttgacatcagttattgatgagaagagtttg
tcagttggacaagataaagagaccaaaggtgaaacaaacattgacaaaaagtgcgaagag
cgggatggtgaaaaccatgaagagaaaaatgagaaggaacttgaagtagcgacacatttg
gtttctacgagtgacaaaagtcaggagaaatctgatacttcaaaacaatctggtgcaatt
tctactgacaaagaaggggaatctgcatcacttaaaaagccagatgatgcaggcttggca
gtgggacagacaccaagtaccacagcagaatcaaatgttttaacgtctaaactagaggtc
ccacctgggttcgaaaaggagtcagttgatgaagcttcaatggccattccttctaactct
ccagatactccgaaagatgaggacatgatgcccgctgtgcaaacaaaggagccagagcaa
tccatgaaatcgaacattgtacttgaaaatggcaaaaatacagggaccgtagaagtcaaa
gactctgtagatgggagaaaagatccattgaagatcaaaaatgatctggatattgataag
atcaaacgtgcagcagtcactgctttgtcagctgctgcagtcaaggcgaagtatcttgca
gatcaagaagaggaccaaattcggctgcttacaacggcattaatagagaagcagttacac
aagctggagagcaagataaccttctttcatgacatggataatgtggttatgagggtcaga
gaactgttggagaggtcaaaacagaggcttgtcagtgagcgtcaacaaataattaatgca
agacgtgctgggccacaacctgtacttgctaaccggcctggaatgactcttgctaattca
gcacctaggcttccaactgcaatgagctccccaaggataccgaattcaagacccataatg
gcaggagcccctacaccaagctcttttatgcctacaacagtttcaggaaattcaatgcag
ccttcaaacagatga

DBGET integrated database retrieval system