KEGG   Capsicum annuum: 107850520Help
Entry
107850520         CDS       T04646                                 

Definition
(RefSeq) histone-lysine N-methyltransferase ASHH3
  KO
K11423  histone-lysine N-methyltransferase SETD2 [EC:2.1.1.43]
Organism
cann  Capsicum annuum
Pathway
cann00310  Lysine degradation
Brite
KEGG Orthology (KO) [BR:cann00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    107850520
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:cann03036]
    107850520
Enzymes [BR:cann01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     107850520
Chromosome and associated proteins [BR:cann03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     107850520
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SET DUF682
Motif
Other DBs
NCBI-GeneID: 107850520
NCBI-ProteinID: XP_016550585
UniProt: A0A1U8ETN2
LinkDB All DBs
Position
12
AA seq 370 aa AA seqDB search
MPAMKTVVHGGIGHVFSKLIKEIGDPVDFELPDWLNKWQSMPYIFIRRNIYLIKKVKRRL
EDDGIFCSCRSTGETSAVCGKDCLCGMLLSSCSSGCQCGSSCLNKPFHQRPVKKMKLVKT
EKCGSGIVADEDIKRGDFVIEYVGEVIDDKTCEERLWKMKHSGETNFYLCEINRDMVIDA
TYKGNKSRYINHSCCPNTEMQKWMMDGETRIGIFAKRDIKRGEHLTYDYKFVQFGADQDC
HCGAVGCRRKLGVKPNKPKLPASDAALKIVACQVAATSPKLKALLSTRHVYQTGVPPIGC
SGYDPDLEQRRPRNCIGQVIRIIGSSDTRSFGIVQRFDAITKKHLIMFEDGCVQYLDLSK
EDWEFCNFVV
NT seq 1113 nt NT seq  +upstreamnt  +downstreamnt
atgcctgccatgaagactgttgttcatggtgggattgggcacgtattcagcaaactaata
aaggagattggtgatcctgttgactttgaacttccagattggttaaataaatggcaatca
atgccctatatctttattagacgcaatatctacctcattaagaaggtaaagcgacgtctg
gaagatgatggtatattttgttcctgccgctcaacgggtgaaacttctgctgtatgtggc
aaggattgtctctgtggcatgctgttgtctagctgctcctcgggttgtcaatgtgggagt
tcttgtctgaataagccattccatcaacgtcctgtgaaaaagatgaaattagtgaagact
gagaaatgtgggtccggaattgtggcagatgaagatatcaaacgaggagattttgttata
gagtatgttggagaagttattgatgacaaaacatgtgaagagaggctctggaaaatgaag
catagtggggaaacaaacttttacttgtgtgaaatcaatcgggatatggtgattgatgcc
acttacaagggcaacaaatccagatacattaatcatagttgttgtccaaatactgagatg
cagaaatggatgatggatggtgaaacaagaataggcatatttgcgaaacgagacattaaa
aggggcgaacatctgacctatgattacaagtttgttcaatttggcgccgatcaagattgc
cattgtggtgctgtaggatgtaggcgaaagctgggggttaaacctaacaagccaaagctc
cctgcttcagatgctgcattaaagatagtggcatgtcaggtggctgccacttctcctaaa
ttgaaagcacttctatctacacgtcatgtttatcaaactggagttcctccaataggatgt
tcaggttatgatcctgacctagaacaaaggcgacctcgtaattgcattggtcaagtaata
agaataatcggctcctctgacacaaggtcctttggaattgtacagcggtttgatgccatc
accaaaaaacatttgatcatgtttgaagatggctgtgttcagtaccttgacctgtcaaaa
gaagactgggaattctgtaactttgttgtgtaa

DBGET integrated database retrieval system