KEGG   Capsicum annuum: 107850578Help
Entry
107850578         CDS       T04646                                 

Definition
(RefSeq) glutamate decarboxylase
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
cann  Capsicum annuum
Pathway
cann00250  Alanine, aspartate and glutamate metabolism
cann00410  beta-Alanine metabolism
cann00430  Taurine and hypotaurine metabolism
cann00650  Butanoate metabolism
cann01100  Metabolic pathways
cann01110  Biosynthesis of secondary metabolites
Module
cann_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:cann00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    107850578
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    107850578
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    107850578
   00430 Taurine and hypotaurine metabolism
    107850578
Enzymes [BR:cann01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     107850578
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC Aminotran_5 Met_gamma_lyase
Motif
Other DBs
NCBI-GeneID: 107850578
NCBI-ProteinID: XP_016550679
UniProt: A0A1U8F3F5
LinkDB All DBs
Position
12
AA seq 502 aa AA seqDB search
MVLSKTASESDVSIHSTFASRYVQTSLPRFKMPENSIPKEAAYQIINDELMLDGNPRLNL
ASFVTTWMEPECDKLMMDSINKNYVDMDEYPVTTELQNRCVNMIAHLFNAPLKDGETAVG
VGTVGSSEAIMLAGLAFKRKWQNKMKAQGKPYDKPNIVTGANVQVCWEKFARYFEVELKE
VKLSDGYYVMNPEKAVEMVDENTICVAAILGSTLNGEFEDVKKLNDLLIVKNKETGWDTP
IHVDAASGGFIAPFLYPDLEWDFRLPLVKSINVSGHKYGLVYAGIGWVIWRSKEDLPDEL
IFHINYLGADQPTFTLNFSKGSSQVIAQYYQLIRLGYEGYKNVMENCQGNARVLREGLEK
TGRFNIVSKDIGVPLVAFSLKDNHKHNEFEISETLRRFGWIVPAYTMPPDAQHITVLRVV
IREDFSRTLAERLVIDIVKVLHELDSLPARVNAKLAVAEEKAAASGVDIVHHKTDREWEL
EVAEAWKKFVADKKKNKTSGVC
NT seq 1509 nt NT seq  +upstreamnt  +downstreamnt
atggttctgtccaagacggcgtcagaaagtgacgtgtccattcactctacgttcgcgtct
cgatatgttcaaacttctcttcctaggtttaagatgccggaaaactcaataccaaaggaa
gcagcatatcaaattataaatgatgaacttatgttagatggaaatccaaggttgaatttg
gcttcttttgtaacgacatggatggaaccagaatgtgataaattgatgatggattcaatt
aacaaaaattatgttgacatggatgaatatccggtcaccactgagcttcagaatcgatgt
gtaaatatgatagctcatttatttaatgcaccactcaaagatggagaaacagcagttgga
gttggaacagttggatcatcagaagcaattatgcttgctggattggcctttaagagaaaa
tggcaaaacaaaatgaaagcccaaggaaagccctatgacaagcccaatattgttactggt
gccaatgtccaggtgtgttgggagaaatttgcaaggtattttgaagtggaactaaaggaa
gtaaaattgagtgatggatactatgtgatgaaccctgagaaagctgtggaaatggtggat
gagaacaccatttgtgtagctgctattttgggttctactcttaatggtgaatttgaagat
gtaaagaaattaaatgacctcttgattgtgaagaacaaagaaactgggtgggacactcca
attcatgtggatgcagcaagtggtggatttattgcaccatttctttatccagaccttgaa
tgggactttagattgccattggtgaaaagtattaatgtgagtggtcacaaatatggtctt
gtttatgctggtattggttgggttatttggaggagcaaagaagatttgcctgatgaactt
attttccacatcaattatcttggtgctgatcaacccactttcactctcaatttctctaaa
ggttctagtcaagtaattgctcaatattaccaacttattcgcttgggttatgagggttac
aagaatgttatggagaattgtcaaggaaatgcaagggtactgagagaaggactagaaaag
acagggagattcaacatagtttccaaagacattggagttccattagttgcattttctctt
aaagacaatcacaaacacaatgagttcgagatttctgaaactttaaggagatttggatgg
attgttccagcatacactatgccaccagatgctcaacacatcactgttcttagagttgtc
atcagagaagatttctctcgaaccctcgccgagcgactggttattgacatcgtaaaagtc
ctccacgaactcgactcactccctgcacgtgtcaatgccaagctagccgtggcagaggag
aaggccgcggcgagtggcgttgacatcgtgcatcacaaaacagatagggaatgggaactt
gaggttgctgaagcatggaagaagtttgttgctgataagaagaagaataaaactagtgga
gtttgttaa

DBGET integrated database retrieval system