KEGG   Capsicum annuum: 107850902Help
Entry
107850902         CDS       T04646                                 

Definition
(RefSeq) glycerol-3-phosphate dehydrogenase SDP6, mitochondrial
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
cann  Capsicum annuum
Pathway
cann00564  Glycerophospholipid metabolism
cann01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cann00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    107850902
Enzymes [BR:cann01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     107850902
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DAO DAO_C FAD_binding_2 FAD_oxidored Pyr_redox FAD_binding_3 Pyr_redox_2 NAD_binding_8 GIDA Lycopene_cycl Pyr_redox_3 HI0933_like
Motif
Other DBs
NCBI-GeneID: 107850902
NCBI-ProteinID: XP_016551199
UniProt: A0A1U8F4X7
LinkDB All DBs
Position
12
AA seq 627 aa AA seqDB search
MATSIYLRRLGAIAAVTGGSYAILRQPSFSSNDRGGDSALENFRRKIADPFTVVPRRETQ
EAALIGSSLANPLDILVVGGGATGCGVALDAVTRGLRVGLVEREDFSSGTSSRSTKLIHG
GVRYLEKAVFNLDYGQLKLVFHALAERKQVIDNCPHLCHALPCMTPCFDWFDAIYYWAGL
KMYDLVAGRHLLHLSRYYSAQESVELFPTLARNGKDKTLKGTVVYYDGQMNDSRLNVALA
CSAALSGAAVLNHAEVVSLLKDEGDGRIIGARIRNNLSGKEFDAYAKVVVNAAGPFCDSV
RTLADKDAKPMICPSSGVHVVLPDYYSPDGMGLIVPKTKDGRVVFMLPWLGRTVAGTTDS
NTSITMLPEPHEDEIEFILDAISDYLNIKVRRIDVLSAWSGIRPLAIDPKAKSTASISRD
HVVTEDHPGLVTITGGKWTTYRSMAEDAVDAAIKSGKLSPANKCLTYNLQLIGADGWDPS
SFTVLAQQYVRMKRSHAGKVVPGAMDTAAAKHLSHAYGVLAERVAAIAQNENLGKRLAHG
HPFLEAEVAYCAREEYCESAVDFVARRCRLAFLDTDAAQRALPRIIEILAAEHKWDKSRQ
KQELQKGKEFLETFKSSKNAQFHDGKH
NT seq 1884 nt NT seq  +upstreamnt  +downstreamnt
atggccacctcaatttacctccgtcgtctcggcgcaatcgccgccgtaaccggcggatca
tacgcaattctccggcaaccttccttctcttccaacgaccgcggcggcgactccgcactc
gaaaattttcgccggaaaatcgctgatccattcaccgtcgtaccacggcgggagactcag
gaagcggcgttgatcggttctagtttggctaatccgcttgatatacttgttgtaggcggc
ggtgcgacgggatgcggtgtcgcacttgatgctgtaacacgtggattacgagttggattg
gttgaacgagaggatttctcttctggcacttcttctaggtctactaagcttattcatgga
ggagttcgctatttggagaaagcagttttcaacttagattatgggcagttaaagctagtt
ttccatgctctggcagagcgtaaacaggtcattgacaattgtccacacctttgtcatgct
ttaccatgcatgactccttgctttgattggtttgacgcgatctactactgggccggcctg
aaaatgtatgatctggtcgctgggcgacacttgctgcatttatctaggtattattctgca
caagagtctgttgaattgtttcctacccttgctcgaaatggtaaagataaaactctgaag
ggaactgtggtatattatgatggacaaatgaacgactcacgcctcaatgttgcattagca
tgctctgctgctttgtctggtgcagccgtgcttaaccatgcagaagttgtttcccttctc
aaagatgagggtgatggtagaataattggtgctcgtatacggaataacttgtcaggaaag
gagtttgatgcatatgcaaaagtagttgttaatgctgctgggcctttctgtgattctgta
cggacgttggctgataaagatgcaaaacccatgatttgtcccagtagcggtgtacatgtt
gtacttcctgattactattctccagacggaatgggcttgattgtccctaaaactaaggat
ggtcgagtggtctttatgcttccatggttgggtagaacagtagctggtaccactgattca
aacaccagcatcacgatgcttccagaacctcatgaggatgagatcgaattcattttggat
gccatctctgattaccttaatattaaggtacgacgtattgatgtcctatctgcttggagt
ggtatccgccctctagcaattgatcccaaggcaaagagtacggcaagcatctccagagat
catgttgtaactgaagatcatcctggtttggtaacaattactggtggtaaatggactact
tatagaagcatggcagaagatgcggttgatgcggctataaaatctggaaaattgagccca
gcgaataaatgcttgacttacaacctacaacttataggtgcagatggatgggatccttca
tcttttacagtacttgctcaacaatatgtccgcatgaaaaggtcacatgcagggaaggtt
gttccaggagcaatggacacagctgctgctaaacatctatctcatgcatatggtgtgtta
gctgaacgagtggctgctattgctcagaacgaaaatctgggaaaacgattggctcatgga
caccctttcctggaagctgaggttgcatactgtgctcgggaagaatactgtgaatctgct
gtagattttgtagctagaagatgtcgtcttgccttccttgacactgatgctgcacagcga
gcgctgccacgtataatagagatactggctgctgagcacaaatgggacaagtctaggcag
aagcaagaactgcagaagggaaaagaatttttagaaacttttaagtcatcaaaaaatgca
caattccatgacggaaagcactag

DBGET integrated database retrieval system