KEGG   Capsicum annuum: 107851744Help
Entry
107851744         CDS       T04646                                 

Definition
(RefSeq) delta(12)-fatty-acid desaturase FAD2-like
  KO
K10256  omega-6 fatty acid desaturase / acyl-lipid omega-6 desaturase (Delta-12 desaturase) [EC:1.14.19.6 1.14.19.22]
Organism
cann  Capsicum annuum
Pathway
cann01040  Biosynthesis of unsaturated fatty acids
cann01100  Metabolic pathways
cann01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:cann00001]
 09100 Metabolism
  09103 Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    107851744
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:cann01004]
    107851744
Enzymes [BR:cann01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.6  acyl-CoA (9+3)-desaturase
     107851744
    1.14.19.22  acyl-lipid omega-6 desaturase (cytochrome b5)
     107851744
Lipid biosynthesis proteins [BR:cann01004]
 Desaturase
  Omega
   107851744
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FA_desaturase DUF3474 Peptidase_M60
Motif
Other DBs
NCBI-GeneID: 107851744
NCBI-ProteinID: XP_016552314
UniProt: A0A2G2YBI1 A0A1U8F7W3
LinkDB All DBs
Position
12
AA seq 384 aa AA seqDB search
MGGGGNMSTPTTTTEAKKNPLKRIPISKPPFTIGDVKKVIPPHCFQRSLIRSFYYVAHDL
SLASAFYYIASTYFHLLPSPYRYLAWVTYWIVQGCVFSGIWMICHECGHHAFSDYTWVDD
TVGFILHSAILMPYFSFKYSHRRHHANTNSIDHDEIYVPRIKSEIPWFNKYSNNPLGRIL
QLVTMLTLGMPLYLIFNTTGKNYGRFASHFDPYGPIYNDRERLWIYISDAGVIATTYVLY
RIALAQGLAWVVCIYGMPLLVMNGSIILVTLLSHTHPSVPFYDSSEWDWLRGALATVDRD
YGVLNKVFHNFVNTHVVHHLFSTIPHYHAEEATKAIKPLLGEYYQFDGTPFYKAFWRETR
DCLYVEKDEGSDHNNGVFWYKNKL
NT seq 1155 nt NT seq  +upstreamnt  +downstreamnt
atgggaggtggtgggaatatgtctactccaacaactacaactgaagcaaagaaaaatcct
ctcaaaagaatcccaatttcaaagcccccttttacaattggtgatgtcaagaaggttatt
cctcctcactgctttcaacgatctctcatccgctcgttttactatgttgctcatgatctc
tcacttgcttccgccttctactacatagcctcgacttactttcacctccttccatctccc
tatcgttacctagcatgggttacttactggattgttcagggttgtgttttttctggaata
tggatgatttgccatgaatgtggccatcatgcctttagtgattacacgtgggtagatgac
actgttggttttatccttcactctgcaattctaatgccatacttctcatttaaatatagc
catcgtcgtcaccacgccaacactaattccattgatcatgatgaaatttacgtgccaagg
attaaatctgaaataccttggttcaacaaatactcgaacaatccactaggacgaatactc
caacttgttaccatgctcactctcggcatgcctttgtacttgatctttaataccacggga
aagaattatggccgctttgcaagtcactttgatccatatggacctatatataatgatcgt
gagaggttatggatctacatttcagatgcaggtgtgattgcaactacttatgtgttgtat
cgcattgctctggcacaaggcctagcttgggttgtatgtatttatgggatgcccctccta
gttatgaatggatccataatattagtgactttgttgagccacactcacccttcagttcca
ttttacgattcatccgagtgggattggttaagaggagctctagctactgtagatagagac
tatggtgtgctaaacaaggtctttcacaatttcgtaaatactcatgtggtgcatcatcta
ttctcaactataccacattaccacgcggaggaggcaaccaaagctatcaagccattacta
ggagaatactaccaatttgatggtactcctttttataaagcgttctggagggagacaagg
gactgcctttacgtggagaaagatgaaggatctgatcacaataatggcgttttttggtat
aaaaacaagctctaa

DBGET integrated database retrieval system