KEGG   Capsicum annuum: 107853724Help
Entry
107853724         CDS       T04646                                 

Definition
(RefSeq) glutamate decarboxylase-like
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
cann  Capsicum annuum
Pathway
cann00250  Alanine, aspartate and glutamate metabolism
cann00410  beta-Alanine metabolism
cann00430  Taurine and hypotaurine metabolism
cann00650  Butanoate metabolism
cann01100  Metabolic pathways
cann01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cann00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    107853724
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    107853724
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    107853724
   00430 Taurine and hypotaurine metabolism
    107853724
Enzymes [BR:cann01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     107853724
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC Aminotran_5
Motif
Other DBs
NCBI-GeneID: 107853724
NCBI-ProteinID: XP_016554190
UniProt: A0A1U8FEL4
LinkDB All DBs
Position
Un
AA seq 496 aa AA seqDB search
MVLSKAASEFDLSVHSTFASRYVRVSLPRFKIPDNSIPKDAAYQIINDELMLDGNPRLNL
ASFVTTWMEPECDKLIMDSINKNYVDMDEYPVTTELQNRCVNMIAHLFNAPLGEGEAAVG
VGTVGSSEAIMLAGLAFKRKWQNKMKAQGKPHDKPNIVTGANVQVCWEKFARYFEVELKE
VKLEDGYYVMDPEKAVEMVDENTICVAAILGSTLNGEFEDVKRLNDLLVEKNNETGWDTP
IHVDAASGGFIAPFIYPEIEWDFRLPLVKSINVSGHKYGLVYAGIGWVIWRNKEDLPEEL
IFHINYLGADQPTFTLNFSKGSSQVIAQYYQLIRLGYEGYKNVMENCEENARVLREGLEK
TGKFNIVSKEIGVPLVAFSLKDNSRHNEFEISDHLRRFGWIVPAYTMPPNAEHMTVLRVV
IREDFSRTLAERLVNDIVKVLNDIDALPARVSAKLAAATEEREGVQKKTAMEVQLEITNI
WKKFVADKKKTKNVIC
NT seq 1491 nt NT seq  +upstreamnt  +downstreamnt
atggttctatctaaggccgcctcggagtttgatctctccgtccattccacctttgcttcg
cgttatgtcagagtttctctccctcggtttaagataccagataattcaataccaaaggat
gcagcatatcaaataataaatgatgaattaatgttggatggaaatccaaggttaaattta
gcatcatttgtgacaacatggatggaaccagagtgtgataagctaattatggattcaatt
aacaagaactatgttgacatggatgaatatcctgtcaccactgagcttcagaatagatgt
gtaaacatgatagcacatttgtttaatgcaccactgggtgagggtgaagcggctgttggt
gttggaacagttggatcctcagaagccattatgcttgctggattagcctttaagagaaaa
tggcaaaacaaaatgaaggcccaagggaaaccccatgacaaacccaatattgttactggg
gccaatgtccaggtatgttgggagaaatttgcaaggtattttgaagtagaattaaaagaa
gtgaaattagaggatggatattatgtgatggaccctgagaaagctgtggaaatggttgat
gaaaatactatttgtgtagctgctattttgggttcaacacttaatggagaatttgaagat
gttaaacgtttgaatgatctcttggttgagaagaataatgaaactgggtgggacacacca
attcatgttgatgcagcaagtggtggattcattgccccatttatttatccagaaattgaa
tgggattttagattaccattagtgaaaagtattaatgtaagtggtcataaatatggtctt
gtttatgctggtattggttgggttatttggagaaacaaagaagatttgcctgaagaactt
attttccacatcaattatcttggtgctgatcaacctactttcactcttaacttctctaaa
ggttctagccaagtaattgcacaatattatcaacttattcgcttaggttatgagggatac
aagaatgttatggagaattgtgaagaaaatgcaagggtactaagagaaggacttgaaaag
acaggaaaattcaacatagtttccaaagaaattggtgtcccattggtagcattctcacta
aaagacaatagtagacacaatgaattcgagatttcagatcaccttagaaggtttgggtgg
atcgtgccagcttacacgatgccacccaatgctgagcacatgaccgtactcagagttgtg
atccgggaagacttttcccggacattggctgagaggctcgtgaatgacattgtaaaagtc
cttaatgatatagacgctctcccggctagggtctcggctaagttagccgcggcgaccgag
gagcgtgaaggtgtgcaaaagaaaacagcaatggaagtgcaattggaaatcaccaatata
tggaagaaatttgttgctgataaaaagaaaaccaaaaatgtaatttgttaa

DBGET integrated database retrieval system