KEGG   Capsicum annuum: 107854728Help
Entry
107854728         CDS       T04646                                 

Definition
(RefSeq) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
cann  Capsicum annuum
Pathway
cann00620  Pyruvate metabolism
cann00710  Carbon fixation in photosynthetic organisms
cann01100  Metabolic pathways
cann01200  Carbon metabolism
Module
cann_M00168  CAM (Crassulacean acid metabolism), dark
cann_M00170  C4-dicarboxylic acid cycle, phosphoenolpyruvate carboxykinase type
cann_M00171  C4-dicarboxylic acid cycle, NAD - malic enzyme type
cann_M00172  C4-dicarboxylic acid cycle, NADP - malic enzyme type
Brite
KEGG Orthology (KO) [BR:cann00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    107854728
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    107854728
Enzymes [BR:cann01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     107854728
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PEPcase PEPcase_2 HTH_Tnp_1_2
Motif
Other DBs
NCBI-GeneID: 107854728
NCBI-ProteinID: XP_016555224
UniProt: A0A2G2YT16 A0A1U8FFX4
LinkDB All DBs
Position
Un
AA seq 965 aa AA seqDB search
MGTRNLEKLASIDAQLRQLVPGKVSEDDKLIEYDALLLDRFLDILQDLHGEDLKETVQEC
YELSAEYESKHDPTKLEELGSVFTSLDPGDSIVIAKAFSHMLNLANLAEEVQIAYRRRQK
LKKKGDFVDENNATTESDIEETFKKLVWDLKKSPQEVFDALKNQTVDLVLTAHPTQSVRR
SLLQKHGRIRDCLAQLYAKDITPDDKQELDEALQREIQAAFRTDEIRRTPPTPQDEMRGG
MSYFHETIWKGVPKFLRRVDTALKNIGINERVPYNAPLIQFSSWMGGDRDGNPRVTPEVT
RDVCLLARMMAANLYYSQIEDLMFELSMWRCNEELRVRADELHRSSRRDEKHYIEFWKQV
PPNEPYRVILGDVRDKLYQTRERSRQLLAHGYSEIPEEAAYTNIEQFLEPLELCYRSLCV
CGDRPIADGSLLDFLRQVSTFGLSLVRLDIRQESDRHTDVLDAITQHLEIGSYREWSEER
RQEWLLSELSSKRPLFGPDLPKTEEIADVLDTFHVISELPAGCFGAYIISMATAPSDVLA
VELLQRECRVRQPLRVVPLFEKLADLDAAPAAVARLFSIEWYRNRINGKQEVMIGYSDSG
KDAGRLSAAWQLYKAQEELIQVAKEFCVKLTMFHGRGGTVGRGGGPTHLAILSQPPETIH
GSLRVTIQGEVIEQSFGEEHLCFRTLQRFTAATLEHGMHPPVSPKPEWRALMDEIAVVAT
ENYRSIVFKEPRFVEYFRLATPELEYGRMNIGSRPSKRKPSGGIESLRAIPWIFAWTQTR
FHLPVWLGFGAAFKYAIEKDIKNLRMLQEMYNAWPFFRVTIDLVEMVFAKGDPGIAALYD
KLLVSEDLWSFGELLRSNYEETKSLLLQIAGHKDLLEGNPYLRQRLRLRDSYITTLNVCQ
AYTLKSIRDPEYSVTPRPHISKEYIESKPAAELVNLNPASEYAPGLEDTLILTMKGIAAG
LQNTG
NT seq 2898 nt NT seq  +upstreamnt  +downstreamnt
atggggactcgtaatttggagaaactggcatctattgatgcacagttgagacaattggtg
cctggaaaagtttctgaagatgataagcttattgagtatgatgctttgcttttggatagg
tttcttgatattcttcaagatttgcatggagaggatctcaaggaaacagttcaagagtgt
tatgagctttctgccgagtatgaaagcaaacatgatccgacgaagctggaggaacttggt
agtgtgtttacaagtttggatccaggggattcaattgtcattgctaaagctttctctcac
atgcttaacttggcgaatttggccgaggaggttcaaattgcctatcgtaggcgccaaaag
ttgaagaaaaaaggggattttgtcgatgagaacaatgcaacaacggagtcagatattgaa
gaaacgttcaagaagctggtgtgggacttgaagaagtcccctcaagaagtttttgatgct
ctgaagaatcagactgtggatctagtcctaacggctcatcctactcaatctgtccgaaga
tcattgcttcaaaagcatggaaggatccgtgactgtttggctcagttgtatgctaaggac
attacacccgatgataaacaagagcttgatgaggctttacagagggagattcaagctgcg
ttccgaactgatgagattcgaagaacacctccaactccgcaagatgaaatgagaggtgga
atgagctatttccatgaaacaatttggaagggtgtaccaaagtttctgcgccgtgttgat
actgctctaaaaaacatagggattaatgaacgagttccttataatgctcctcttattcaa
ttctcctcttggatgggcggtgatcgtgatggtaatccaagagtgactcctgaggtcaca
agagatgtttgcttattggccagaatgatggcagcaaacttgtactattcgcaaatagag
gacctcatgtttgagttatctatgtggcgctgcaatgaagagcttcgcgtacgagcagat
gaactccataggtcttcaaggagagatgaaaaacactacatagaattttggaagcaagtt
cctccaaatgagccctatcgtgtaattcttggtgatgtgagagacaagctttatcagacg
cgtgagcgttctcgccaacttttagcccatggatactctgaaattccagaggaagcagct
tatactaatattgagcagttcttggaacctcttgaactctgctacagatctctttgtgtt
tgtggtgatcgccccatcgctgatggtagccttctggatttccttagacaagtttctacc
tttggactttcacttgtgagacttgacataagacaagaatcagaccgccatactgatgtt
cttgatgctattacccagcatttggaaattggttcatatcgagaatggtctgaagaacgt
agacaagagtggcttctgtctgaactcagcagcaagagacctttatttggacctgatctt
ccaaaaactgaagaaattgctgatgttttggatactttccatgtcatatccgaactccca
gccggctgtttcggggcatacatcatctcaatggccaccgcaccgtctgatgtgcttgca
gttgagcttctacagcgtgaatgccgagtgcggcaacctttaagagttgttccacttttt
gagaagttggctgatctggatgctgctcctgctgcagttgcacgtcttttctcaattgag
tggtacagaaaccgaattaatggcaagcaagaggtcatgattggatactctgactctggc
aaggatgcaggtcggctatcagcagcctggcagttatataaggctcaagaggagcttata
caagtcgccaaggagttctgcgtgaagctaaccatgttccatggtagaggtggtacagtg
ggaagaggaggtggccccactcatcttgctatattgtctcaaccacccgaaacaattcac
ggatctctccgtgttaccattcaaggtgaggttattgagcaatcttttggggaagaacac
ttgtgttttaggacgcttcagcgttttactgctgctactcttgagcatggaatgcatcca
ccagtctctccaaaaccagaatggcgtgcgcttatggacgaaattgcagttgttgctaca
gaaaattatcgatcaatagttttcaaggaaccccgatttgtcgagtatttccgtctggct
acacctgagttggagtatggtcgaatgaacattggtagccgtccatcaaagcgtaaacct
agcggaggcatagaatcacttagagctattccatggatcttcgcctggactcagactaga
tttcatcttccagtctggctcggctttggagcagcatttaagtatgcgattgaaaaggac
atcaagaaccttcgcatgctgcaggaaatgtacaatgcatggccattctttagggtaact
attgatttggttgagatggtgttcgccaaaggagatccaggcattgctgcattgtacgac
aagcttctggtatcggaagatttgtggtcctttggtgaacttcttaggtcaaactacgaa
gagacaaagagcctcctgctgcagattgctggacacaaggatcttcttgagggtaaccca
tacttgagacaacgactcagattgcgtgactcctacatcacaacattgaacgtgtgccaa
gcctacaccctaaagagtattcgtgatccggaatacagtgtcacaccaaggcctcacatt
tccaaggaatacattgagtcaaagccagctgctgaacttgtgaacctgaacccagctagt
gaatatgcccctggcttggaggacacactcatcttgaccatgaagggtattgctgctgga
ctgcagaatactggttaa

DBGET integrated database retrieval system