KEGG   Capsicum annuum: 107855291Help
Entry
107855291         CDS       T04646                                 

Definition
(RefSeq) centromere-associated protein E
Organism
cann  Capsicum annuum
SSDB OrthologParalogGFIT
Motif
Pfam: KIP1 UPF0242 ATG16 Leu_zip Ribosomal_S15
Motif
Other DBs
NCBI-GeneID: 107855291
NCBI-ProteinID: XP_016555765
UniProt: A0A1U8FAR7
LinkDB All DBs
Position
Un
AA seq 1237 aa AA seqDB search
MTKHRFREKVKSFFGSHVDPEKDKELKGTKAEIEGKIQKILAYLKGDGRDEKEPLVEIVQ
DFHNHYQSLYDRYDHLTGKLRENVQGKHEKDTSSSSSGSDSDSDFSTKNKGKKNGKLEFT
EVTDGIKEELASANLEIVELKAQLTAAKEEKEALQSEHQSASSKLQEAETTISSLTSEAE
RLKEENSKLLGETVVLKENLERSAKSEAELMQKLDEITRERESLLLEKQSMGNSVLESNS
TIEELRTTMGQLKEEKETLQVDLEALKSELPSVKEQLDSAEKEIAQLSQTQKATEEDNSS
LSSKVLQLSEEIGQAQQKIQDLVTEADQLKGMLDEKEKEFSSHKEVHDAHKNESSTRLRG
MELEIDSLQSQKSEIEKQKEDELSALLKKLEEKEEEFSLQTEALTSKMNNMQLEIDSLNE
LKGKLEEQMEQERSKMSAEVENLTNEVNKKDQELESLCSQKLELEAELEKKAQEIAGFSS
ERESFKQDIANKSAESLKILEEKESSLSQVKDLEVELKSLQNLKLEFEEQLTSKDETIAQ
MKNDKEMMQDKISEIERALTERESELAILRKKSEEGETESSTQIAALTLQVSNLQEHLEN
LQVQKSQVESQLEAKAGEASEYLTQLENLKEELATKISHGQRSLEEKEGLAVQVREEKGN
LLSKISELEFALAEKVEEHGTLRQKLKEMQNEASTQIVALTEEVNKLKLQIELLQTEKGQ
LELVIESGKQESAESLAEAENQITELSQKILDQEIKLKEQEEALSKLVEERDSLVVQVND
LQAEVKSLCEQKSTLEEDISSADNENNLLKEEKGSLLSKLSELEFTLAEKLEVHETLQKK
LEDVQNEASTQIAALTEEVNELRQKIEALQTEKSQLELLIENGKQESTETLAQAKNQHTE
LSQKIVDREMKLKEHEEAFGKLDEEHKKLDGVLQEYKESLKLAEMKIEEITEEYQKNLES
KDRKIDELDDKIEDLKRDLEMKGDEISTLVDNVRNTEVKLRLTNQKLRVTEQLLTEKEED
HLKKEEKLLQHQRFLEERIATLSGVIAVYKETQAKIIADLSDKVSDTLTQIDTFNMKFEE
DTGHLESRIYEILNELKVALNLIKVAGEEKKQLKKEIDILLQQLKDEKECASVLKEKVEQ
LENAEKNEVTQRGSLTETVHQLEEKIATLHKIIAEKDEKMGEYERKMNDKDKGMLDLSEE
KREAIRQLCIWIDYHQSRYDDLIEMISKARGRRQVAA
NT seq 3714 nt NT seq  +upstreamnt  +downstreamnt
atgacaaagcatcggttcagggaaaaagtcaagtccttttttggaagtcatgttgatcct
gagaaagataaggagctgaaaggaaccaaagctgaaattgaaggcaaaattcagaagatc
ttagcctatcttaaaggagatggcagagatgaaaaagaaccactggtggagatagttcaa
gattttcacaatcattaccaatcactgtatgatcgttatgaccatctcactggaaaactg
agggaaaatgtacagggaaaacacgagaaagatacttcttcctccagctcaggctcagat
tcagattcagacttcagtacgaaaaataagggcaagaaaaatggtaaactggaattcaca
gaagtaacagatggcatcaaggaagaattggcaagcgcaaatctggaaatagttgaattg
aaggctcagttgacagctgcgaaagaagaaaaggaggctttgcaatccgagcatcagagc
gcttcgagcaaattgcaagaagcagaaacaacaatcagtagtttgactagcgaagcagaa
aggttgaaggaagaaaattcaaagcttctaggtgagacagtggtcctcaaagagaatttg
gagagatctgcaaaatcagaagctgaattaatgcagaagctcgacgagataactagagaa
agagaaagcttactcttggagaaacaatccatgggaaacagcgttttagaaagcaatagt
actattgaagaattaagaaccactatggggcagttgaaggaagagaaagaaaccctacag
gtagatttggaagccctcaaaagcgaacttccctcggtgaaggaacaactcgattctgct
gaaaaggaaatagctcagctaagtcaaacgcaaaaggccacagaggaagacaattcttca
ctatcatcgaaagttttacagctctcggaggagatagggcaagctcaacagaagatccaa
gaccttgtgactgaagctgaccagctaaaggggatgttagatgagaaagaaaaggagttc
tcttctcacaaggaggtacatgatgctcacaaaaatgaatcatcgacccgtttaagaggt
atggaactggagattgattcactgcagtctcagaaatcagaaatagagaaacaaaaggaa
gatgagctctctgcgttgctgaagaaacttgaggaaaaggaggaagaattctcattgcag
acggaagctttgacatcaaagatgaacaatatgcaacttgaaatcgactccttgaatgaa
ctgaaaggcaagttggaggagcaaatggagcaagaaagaagcaagatgtcagctgaagtt
gaaaacttaacaaacgaggtgaataagaaggaccaagaattagagtctctttgcagccag
aaacttgaattggaagcagaactggagaagaaagcacaagaaattgcgggattctcaagt
gagagagagagtttcaagcaggatatagcaaacaaatctgcagagtcactgaaaattctg
gaagagaaagaaagttctctttcacaagtgaaggacctagaagtggagctaaaatcactt
cagaatctgaaacttgagttcgaagagcagttgacaagcaaagatgagacgattgctcag
atgaaaaacgacaaggagatgatgcaagataaaatttctgaaattgagagggcattaact
gagagagaaagtgaactagctattttaaggaagaaatctgaagaaggagaaactgaatca
tctactcagattgcggccttaactttacaggtgagcaatctgcaagagcatttggagaat
ttgcaagttcagaagtctcaagtagagtctcaactcgaggcaaaagctggagaagcatca
gaatacctcactcagttggaaaatttgaaggaggaattagcaacgaaaatatcacatggc
cagagatcgctggaagagaaggagggcctagcggtacaggtcagggaggaaaagggaaat
ctcctaagcaaaatatctgaactagaatttgcattagcggagaaagtggaagagcatgga
accttgcgacagaagctaaaggaaatgcaaaacgaagcttctactcagattgttgccttg
actgaagaagttaataagttaaagctgcagatagaattgctgcagaccgagaaaggccag
ctggagttggtaattgagagtggtaaacaagaatctgctgaaagtttggcagaagcagag
aatcagatcactgaattatcacaaaagattttggatcaggaaataaagctgaaagagcag
gaggaagcactctcgaagttggtggaagagagggacagtctagtggtacaggtcaatgat
ctccaggccgaagtgaagtctctttgtgaacagaagagtacattggaagaagacataagc
agtgcagacaatgagaacaatctactgaaggaggaaaagggaagtctcctaagcaagcta
tctgaactggaattcacattagcggagaaattggaagtgcatgaaactttgcaaaagaag
cttgaggatgtgcaaaatgaagcttctactcagattgctgccttgacggaagaagttaat
gagttaaggcagaagatagaagcactgcagactgagaaaagccagctggaattgctaatt
gaaaatggtaaacaagagtccactgagactttggcacaagcgaagaatcagcacacggaa
ttatcacaaaagattgtggatcgggaaatgaagctgaaagagcatgaggaagcatttgga
aagttggatgaagagcacaaaaagctcgatggtgtgctgcaggagtacaaagaaagtctc
aaacttgcagaaatgaagattgaagagataacagaagaataccagaagaatcttgaaagt
aaagatcggaaaatagacgaactggatgacaagattgaagatctgaagagggatctagaa
atgaaaggagatgaaatcagcacactggtggacaatgtccggaacactgaggttaagcta
cgattaaccaaccagaagcttcgggtgaccgaacagttgctgaccgagaaagaagaggac
cacctgaagaaagaagagaagttactgcaacatcaaaggttcctggaagagaggattgca
acattatcaggggttattgctgtatacaaggaaactcaagccaaaataatagcagacctt
tcagataaagtaagtgacactttgactcaaatagatacgttcaatatgaagtttgaggaa
gacaccggtcacctggagtcccgcatttacgaaatattgaatgagcttaaggttgctttg
aacttgatcaaagtagcaggtgaagaaaagaagcagctgaagaaggaaatcgacattcta
ctgcaacaactgaaagatgagaaagaatgtgcatcggtgctaaaagagaaggttgaacaa
ttggaaaacgcagagaaaaacgaggtgactcagaggggtagtttgacggaaactgttcac
caacttgaagagaagatagctacattgcataaaatcattgcagagaaggacgaaaagatg
ggagagtatgaaaggaagatgaatgacaaagataaaggaatgttagacttgagtgaggaa
aaacgggaggcaataaggcagttatgtatttggatcgattaccaccagagtcgctatgat
gatcttatagagatgatctcaaaggctagaggaagaagacaagtagctgcttga

DBGET integrated database retrieval system