KEGG   Capsicum annuum: 107859955Help
Entry
107859955         CDS       T04646                                 

Definition
(RefSeq) succinate dehydrogenase [ubiquinone] flavoprotein subunit 1, mitochondrial
  KO
K00234  succinate dehydrogenase (ubiquinone) flavoprotein subunit [EC:1.3.5.1]
Organism
cann  Capsicum annuum
Pathway
cann00020  Citrate cycle (TCA cycle)
cann00190  Oxidative phosphorylation
cann01100  Metabolic pathways
cann01110  Biosynthesis of secondary metabolites
cann01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:cann00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    107859955
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    107859955
Enzymes [BR:cann01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     107859955
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 Thi4 GIDA FAD_binding_3 DAO HI0933_like
Motif
Other DBs
NCBI-GeneID: 107859955
NCBI-ProteinID: XP_016560609
UniProt: A0A1U8FY17
LinkDB All DBs
Position
2
AA seq 632 aa AA seqDB search
MWRCVSRGLRASSNRSISGGGARHFRRLFSSQSQNVGGSSYTVVDHTYDAVVVGAGGAGL
RAAIGLSEHGFNTACITKLFPTRSHTVAAQGGINAALGNMTEDDWRWHMYDTVKGSDWLG
DQDAIQYMCREAPKAVIELENYGLPFSRTEDGKIYQRAFGGQSLDFGKGGQAYRCACAAD
RTGHALLHTLYGQAMKHNTQFFVEYFALDLLMNSDGSCQGVIALNMEDGTLHRFRSANTI
LATGGYGRAYFSATSAHTCTGDGNAMVARAGLPLEDLEFVQFHPTGIYGAGCLITEGSRG
EGGILRNSEGERFMERYAPTAKDLASRDVVSRSMTMEIREGRGVGPLKDHIYLHLNHLPP
EVLKERLPGISETAAIFAGVDVTKEPIPVLPTVHYNMGGIPTNYHGEVVTIKGDDPDSVV
PGLMAAGEAACASVHGANRLGANSLLDIVVFGRACANRVAEIQRPGETQKPLEKDAGERT
IAWLDKIRNSNGSLPTSKIRLNMQRVMQNNAAVFRTQETLEEGCQLIDKTWESFHDIQLK
DRSLIWNSDLIESIELENLLINACITMHSAEARKESRGAHAREDFTTRDDENWMKHTLGY
WENEKVRLDYRPVHMNTLDDEIETFPPKARVY
NT seq 1899 nt NT seq  +upstreamnt  +downstreamnt
atgtggcgctgtgtgtcgcgtggtcttcgcgcttcctccaacagatccatctccggtggc
ggcgcccgccattttcgccgactcttctcctcacaatctcagaatgtgggaggctcgtcc
tacacggtagtggatcacacatacgatgcggtggtggtcggtgcaggtggtgcagggctt
cgagcagcaatagggttgtctgagcatggattcaatactgcttgcataaccaagctcttt
cctactcgatctcacactgttgccgctcagggtggtataaatgctgcattaggcaatatg
acagaggacgattggaggtggcacatgtatgatacagttaaaggaagtgactggttaggt
gatcaggatgctatccaatacatgtgtagagaagcaccaaaagcagttatagagcttgag
aattatggtttgcctttttctcgaactgaagatggtaaaatttatcaacgtgcatttggt
ggtcaaagcctggacttcggaaaaggaggacaagcatatcgttgtgcatgtgctgcggat
cggactgggcatgctctgttgcatactctttatggccaggccatgaagcataatacacaa
ttttttgtggaatattttgctttggatttactaatgaacagtgatggtagctgccaaggt
gtaattgcattaaatatggaggatggtaccttgcatcgattccgttctgccaatacaatt
ttggccacagggggctatggccgtgcttacttctcggcaacatctgctcatacttgcacc
ggagatggtaatgctatggttgcacgtgctgggcttcctcttgaggatcttgagtttgtg
cagtttcatccaactggtatatatggagctggttgcctcattactgaaggatctcgtggt
gaaggtggtatcctgaggaacagtgagggtgagcgatttatggaaaggtacgccccaact
gccaaggatcttgcatcaagagatgtcgtttccagatcaatgacaatggaaattcgagaa
gggcgtggcgtagggccattgaaggaccatatctatcttcacctcaatcacttgccccca
gaggtccttaaggagagacttccgggtatctctgaaacagctgccatttttgctggtgtt
gatgtaactaaggagccaattcctgttttacctaccgtgcattataatatgggaggaatc
ccaactaattaccacggagaggtggtcactattaaaggggatgatccagattctgtggtc
cctggactgatggctgctggtgaagcagcatgtgcatctgttcatggtgccaatcgtctt
ggtgcaaattctcttctagatattgttgtttttgggagggcatgtgctaatagggttgcg
gagatccaaagaccaggtgagacacagaagccacttgaaaaggatgctggagagaggacc
attgcatggttggacaagattaggaactcaaatggttcattgcccacctcaaagataagg
ctgaacatgcaaagagttatgcaaaacaatgctgctgtcttccgtacacaagagacatta
gaggaaggttgccagctcattgacaaaacatgggagagtttccatgatattcagttgaag
gatagaagtttaatatggaactcagatcttatagagagtattgagctggaaaacctttta
atcaatgcatgcatcaccatgcactcggctgaggcaagaaaagaaagcagaggagctcat
gctcgtgaagattttacgacaagagatgatgagaattggatgaaacatactctaggatat
tgggagaacgagaaagttcggctagattacagaccagtgcatatgaacactctcgatgat
gaaattgagacgttcccaccaaaggcacgtgtttactga

DBGET integrated database retrieval system