KEGG   Capsicum annuum: 107860713Help
Entry
107860713         CDS       T04646                                 

Definition
(RefSeq) succinate dehydrogenase [ubiquinone] iron-sulfur subunit 2, mitochondrial
  KO
K00235  succinate dehydrogenase (ubiquinone) iron-sulfur subunit [EC:1.3.5.1]
Organism
cann  Capsicum annuum
Pathway
cann00020  Citrate cycle (TCA cycle)
cann00190  Oxidative phosphorylation
cann01100  Metabolic pathways
cann01110  Biosynthesis of secondary metabolites
cann01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:cann00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    107860713
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    107860713
Enzymes [BR:cann01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     107860713
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Fer2_3 Fer4_17 Fer4_10 Fer4_8 Fer2 Fer4_7
Motif
Other DBs
NCBI-GeneID: 107860713
NCBI-ProteinID: XP_016561655
UniProt: A0A1U8FS98
LinkDB All DBs
Position
2
AA seq 274 aa AA seqDB search
MATGLIRRAISRVQVTSPAARLLVGRSHASDAKAQPVESKPNLKSFQIYRWNPDNPGKPE
LQEYKIDLKECGPMVLDALIKIKNEIDPSLTFRRSCREGICGSCAMNIDGCNGLACLTKI
SSDSESTITPLPHMFVIKDLVVDMTNFYNQYKSIEPWLKRKTPAPTPGKEIPQSKSDRAK
LDGMYECILCACCSTSCPSYWWNPESYLGPAALLHANRWIMDSRDEYTQERLDAINDEFK
LYRCHTILNCSRACPKGLNPGKHIQNIKRLELSS
NT seq 825 nt NT seq  +upstreamnt  +downstreamnt
atggcgactggtttaatccgacgagcaatttctagggttcaggtaacatcgccggcggcg
aggctcctcgtcggccgatctcacgcctccgacgccaaagcacagccggtagaatcgaag
ccgaatctgaaatcatttcaaatttaccgatggaatccggacaacccggggaaaccggag
ctccaggaatacaaaatcgatctgaaggaatgcggtccaatggttctagacgcgttaatc
aaaatcaaaaacgaaatagatccttcgcttacgtttaggagatcttgcagagaagggatc
tgtggttcctgtgcaatgaacattgacggctgcaacggacttgcttgtttgacgaagatc
tcatcggattctgaatcgacgattacgccgttgccacatatgtttgtgattaaggatctg
gtggttgatatgactaatttttataatcagtataagtctattgagccttggcttaagagg
aagacacctgcaccaactcctgggaaagagataccgcagagtaagagtgatagggctaaa
ttggatggcatgtatgagtgtattctttgtgcttgctgcagcacatcttgtcctagctac
tggtggaatcctgagtcttatcttggtcctgctgcactcctccatgccaaccgatggatc
atggatagccgtgatgaatatactcaggagcgtctggatgcaattaatgacgaattcaag
ctttatcgttgccatactattctgaattgttctcgtgcttgtccaaagggattaaatcct
gggaagcatattcagaacatcaagcgtctggagttgtcatcttga

DBGET integrated database retrieval system