KEGG   Capsicum annuum: 107861787Help
Entry
107861787         CDS       T04646                                 

Definition
(RefSeq) hexokinase-1
  KO
K00844  hexokinase [EC:2.7.1.1]
Organism
cann  Capsicum annuum
Pathway
cann00010  Glycolysis / Gluconeogenesis
cann00051  Fructose and mannose metabolism
cann00052  Galactose metabolism
cann00500  Starch and sucrose metabolism
cann00520  Amino sugar and nucleotide sugar metabolism
cann01100  Metabolic pathways
cann01110  Biosynthesis of secondary metabolites
cann01200  Carbon metabolism
Module
cann_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
cann_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:cann00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    107861787
   00051 Fructose and mannose metabolism
    107861787
   00052 Galactose metabolism
    107861787
   00500 Starch and sucrose metabolism
    107861787
   00520 Amino sugar and nucleotide sugar metabolism
    107861787
  09110 Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    107861787
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:cann04131]
    107861787
Enzymes [BR:cann01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.1  hexokinase
     107861787
Membrane trafficking [BR:cann04131]
 Autophagy
  Mitophagy
   Other mitophagy associated  proteins
    107861787
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hexokinase_2 Hexokinase_1
Motif
Other DBs
NCBI-GeneID: 107861787
NCBI-ProteinID: XP_016562641
UniProt: A0A1U8FU08
LinkDB All DBs
Position
3
AA seq 495 aa AA seqDB search
MKKATVGAAVVGAAAVCAVAALIVNHRMRKSNKWARAISILREFEEKCGTPDSKLKQVAD
AMTVEMHAGLASEGGSKLKMLITYVDNLPTGDEAGVFYALDLGGTNFRVLRVQLGGKDGG
IIHQEFAEASIPPSLMVGTSDALFDYIAAELAKFVAEEEEKFHQPDGKQRELGFTFSFPV
MQTSINSGTIMRWTKGFSIDDAVGQDVVGELTKAMKRKGVDMRVSALVNDTVGTLAGGKY
THKDVAVAVILGTGTNAAYVERVQAIPKWHGPVPKSGEMVINMEWGNFRSSHLPLTEYDH
ALDNESLNPGEQIFEKMTSGMYLGEILRRVLLRVAEEAGIFGDEVPPKLKNPFVLRTPDM
SAMHHDTSSDLKIVGDKLKDILEISNTSLKTRRLVVEFCNIVATRGARLAAAGVLGILKK
MGRDTPRQGGPERTVIAMDGGLYEHYTEYSTCLENSLKELLGEELAASIVFVHSNDGSGI
GAALLAASHSMYLEE
NT seq 1488 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaggcgacggtgggtgccgccgtggttggcgctgctgcggtttgtgctgtggcg
gcattaatagtaaaccaccggatgcgtaaatctaacaaatgggctcgtgctatctctatt
cttcgtgaatttgaggaaaagtgtgggacccctgattctaagctgaagcaagttgctgat
gctatgactgttgagatgcacgctggacttgcatctgaaggtggtagtaagctcaagatg
cttattacctatgtcgataatctccctactggggatgaagccggcgtcttttatgcattg
gatcttggtggaacaaattttcgagtattgcgagttcagttgggcggaaaagatggtggt
attattcatcaagaatttgcggaggcatcaattcctccaagtttgatggttggaacttca
gatgcactttttgattatattgcggcagaacttgcaaaatttgtcgctgaggaagaggaa
aagtttcatcaacctgatggtaagcagagagaactaggtttcaccttctcattcccagta
atgcagacttcaatcaactctgggactattatgcggtggacaaagggcttttctattgat
gatgcggttggccaagatgttgttggagaactcacaaaagctatgaaaaggaaaggcgtc
gatatgcgggtatcagctctggtgaatgacaccgttggaacgttggctggtggtaaatat
acacacaaggatgtagctgttgctgttatcttaggtacagggaccaatgcagcttatgtg
gaacgggtgcaggcaattccaaagtggcatggtcctgtgccaaaatctggtgaaatggtt
atcaatatggaatggggtaattttaggtcatcccatctccccttgacagagtatgaccat
gcgttggataacgagagcttgaatcctggtgaacagatatttgagaagatgacatctggc
atgtacttgggagaaattttacgtagagttctactcagggtggctgaagaagctggcatt
tttggtgatgaggtccctccaaagctcaagaatccatttgtgttgaggacacctgatatg
tctgctatgcatcatgacacatcctctgatctgaaaatagttggtgacaagctgaaggac
attttagagatatctaatacctccttgaagacgaggagattagtggttgagttttgcaac
attgttgcaacgcgtggggcaagacttgcagctgcaggggtattgggaatcctgaaaaag
atgggaagagatacgccaaggcaaggtggtccagaaaggactgttatagccatggatggc
ggattgtatgagcactatacagaatatagtacgtgcttagagaactctttgaaagaattg
ctcggagaggaattggcagcgagcattgtttttgtgcactcgaatgatggttctggcatt
ggtgctgctcttcttgctgcctctcactcaatgtaccttgaagaatag

DBGET integrated database retrieval system