KEGG   Capsicum annuum: 107870314Help
Entry
107870314         CDS       T04646                                 

Definition
(RefSeq) alpha-glucosidase-like
  KO
K01187  alpha-glucosidase [EC:3.2.1.20]
Organism
cann  Capsicum annuum
Pathway
cann00052  Galactose metabolism
cann00500  Starch and sucrose metabolism
cann01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cann00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    107870314
   00500 Starch and sucrose metabolism
    107870314
Enzymes [BR:cann01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     107870314
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 NtCtMGAM_N Gal_mutarotas_2
Motif
Other DBs
NCBI-GeneID: 107870314
NCBI-ProteinID: XP_016572292
UniProt: A0A2G2ZG61 A0A1U8GM09
LinkDB All DBs
Position
5
AA seq 898 aa AA seqDB search
MNIHSTDKSIKSCTFIVLSNFLLSFTLLVQLLALTTNSEPIGYGYIVRSVGVDSSGRTLT
ASLQLIKGSSVYGPDIQNLSLTACFETKDRLRVRITDADHERWEVPQEFIPRETHSSPRS
SLLEKRSSTSLPSSEDTHYFHTSTISDLSFTLYNTTPFGFTITRRSSGDVLFDTSPKNDF
PDTFLIFKDQYLQLSSSLPANRSSIYGLGEHTKRTFKLEHNQTLTLWNADIGSVNVDVNL
YGSHPFYMDVRSHPGVGTSHGVLLFNSNGMDIVYTGDRITYKVIGGVIDLYFFAGPAPEL
VMEQYTELIGRPAPMPYWSFGFHQCRYGYKDITEVRNVVAGYAKAQIPLEVMWTDIDYMD
GYKDFTLDPVNFPLDQMKKLVDTLHHNGQRFVLILDPGISINSSYETYKRGMQADVFIKR
DGVPYLGEVWPGKVYFPDFINPRGRVFWSNEIKIFHDLLPVDGLWLDMNELSNFISSPPT
PFSTLDNPPYKINNSGSLRPINEKTVPATSVHFGNALEYNVHNLYGFLEAKTTNAALIDI
TGKRPFILSRSTFVGAGKYTAHWTGDNAATWDDLAYSIPGILSSGIFGMPMVGADICGFA
RNTTEELCRRWIQLGAFYPFARDHTEKFSIHQELYIWDSVAATAKKVLGLRYRLLPYFYT
LMFEAHTKGIPIARPLFFSFPEDTNAYTIDSQFLIGKGLMISPVLTSGAVSVDAYFPSGT
WFNMFNYSNYVNMKSGGYISLDAPPDHINVHLQEGNIVAMQGEAMTTRAARETPFELLVA
INNRGNSSGEVFLDDGEDVEMGREGGKWNLVKFHTDVVNNKLYLRSKIVNEEFALSKNWT
IHKVTFLGLKKGVSKIRAYNLATKIGTKIDRSASGVLEMTGLSVLIRKEFSIELTLAK
NT seq 2697 nt NT seq  +upstreamnt  +downstreamnt
atgaacatacacagtactgataaatctataaaatcttgtacatttattgttctatccaat
tttctcttgtctttcactttattggttcaattattagcacttacaacaaattctgaacca
attggatatggttatattgttagatcagtaggtgttgactcatctggaaggacactgact
gctagtcttcagcttatcaaaggttcttctgtttatggacctgacattcaaaatcttagc
cttactgcttgctttgagacaaaagatcgtttaagagtcagaattacggatgcagatcat
gaaagatgggaagttcctcaagaatttatcccccgtgaaacacattcatccccccgaagc
tccctgctagaaaagcgctcttctacctcacttccatcatctgaagacacccattacttc
cacacgagcaccatttctgaccttagtttcactctctacaacaccaccccttttggattt
actatcacgcgtcgttcctcaggtgacgttctttttgacacctcacctaaaaatgacttt
ccggacacgttcctcatcttcaaggatcagtaccttcaattgtcctcttcattgccagct
aatcggtcatctatctatggcctcggggagcataccaagagaacatttaagctcgagcat
aaccagacattaactctttggaatgctgatattggtagtgtcaatgttgacgtcaacttg
tatggttcccaccctttttacatggatgtcaggtctcatcctggggtcgggaccagtcac
ggagtcttgctcttcaatagcaatggtatggacattgtgtatactggtgacagaattacc
tacaaggtgattggaggggtcattgacttgtacttctttgctggtcctgcgccagagttg
gtcatggagcagtacacagagctcattggccgccccgcgcccatgccatactggtctttt
gggtttcatcaatgccgatatggttataaagatattactgaagttcggaatgtggttgct
ggctatgcaaaagctcagatccctcttgaggtcatgtggacagatattgattatatggat
ggttataaggatttcacacttgatcctgttaacttcccacttgaccagatgaagaaactt
gttgatacacttcaccacaatggccagagatttgttctcatattggatccagggatcagc
ataaatagctcatatgagacatacaagagagggatgcaagctgatgttttcatcaaacgc
gatggtgttccttatcttggagaagtttggcctggaaaagtctactttcctgatttcata
aatccccgaggcagagtcttctggagtaatgaaatcaaaattttccatgaccttctcccc
gttgatgggctctggcttgacatgaacgagttatctaacttcatttcttctcctccaacc
ccattttctacccttgacaaccctccttataagatcaataattccggaagcttacgtcca
attaacgagaagactgtcccagcaacatcagtacattttggaaatgccttagagtacaat
gttcataacctctacggattcctggaagctaaaaccaccaatgctgctttaatcgatatt
actggtaaaaggccatttatacttagcagatctacctttgtgggtgctggcaagtacaca
gcacattggactggagataatgcagccacatgggatgacttggcttatagtattcccggc
attttgagttccggaatatttgggatgcccatggttggagctgatatatgtggctttgct
agaaatactactgaagaattatgtcgccgttggattcagcttggtgcattttatcccttt
gcaagggaccacactgagaagttctctatccatcaagagctatatatttgggattcagta
gctgcaacagccaagaaagtgcttggactacgctaccgactcttaccatacttctacacg
ttaatgttcgaggcacataccaaaggcatccctatagcacggcctcttttcttctcattc
cccgaggatacaaacgcttacaccatcgactctcagtttctcattggtaaggggttaatg
atatcaccagtattgacatctggtgcagtttcagttgatgcatattttccatccggtacc
tggttcaacatgttcaactattcaaactacgtgaacatgaagtccggtggctacatcagc
ctagatgcgcctcctgatcatatcaacgtgcacctccaagagggaaacattgtggcaatg
caaggagaagcaatgacaacaagagcagcaagggaaactccatttgaactacttgttgcc
atcaacaacaggggaaatagttcaggagaagtcttcttggacgatggtgaagacgttgaa
atgggaagagagggaggaaaatggaaccttgtgaaatttcacactgatgttgtgaacaac
aagttatatctcagatcgaagattgtgaatgaagagtttgctttgagtaagaattggaca
atacacaaagtcacttttcttggactgaaaaagggggtgagcaaaataagagcatataat
ttggccactaaaattggaacaaaaattgatagaagtgcatctggtgttctggagatgaca
ggtttatcagttcttattagaaaagaattttctattgagctaacacttgccaaataa

DBGET integrated database retrieval system