KEGG   Capsicum annuum: 107874232Help
Entry
107874232         CDS       T04646                                 

Definition
(RefSeq) sorbitol dehydrogenase
  KO
K00008  L-iditol 2-dehydrogenase [EC:1.1.1.14]
Organism
cann  Capsicum annuum
Pathway
cann00040  Pentose and glucuronate interconversions
cann00051  Fructose and mannose metabolism
cann01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cann00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    107874232
   00051 Fructose and mannose metabolism
    107874232
Enzymes [BR:cann01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.14  L-iditol 2-dehydrogenase
     107874232
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_zinc_N_2 Sacchrp_dh_NADP Methyltransf_25 Pyr_redox_2 NCD3G UDPG_MGDP_dh_N TrkA_N
Motif
Other DBs
NCBI-GeneID: 107874232
NCBI-ProteinID: XP_016576560
UniProt: A0A1U8GZL2 A0A2G3AHG2
LinkDB All DBs
Position
1
AA seq 355 aa AA seqDB search
MGKGGSDENMAAWLLGVNTLKIQPFNLPALGPHDVRVRMKAVGICGSDVHYLKTLRCADF
VVKEPMVIGHECAGIIEEVGGEVKTLVPGDRVALEPGISCWRCDLCKEGRYNLCPEMKFF
ATPPVHGSLANQVVHPADLCFKLPDNISLEEGAMCEPLSVGVHACRRANVGPETNILVLG
AGPIGLVTLLAARAFGTPRIVIVDVDDYRLSVAKKLGADDIVKVSTNIQDVATDIQNIQK
AMGVGIDVSFDCAGFNKTMSTALGATRPGGKVCLVGMGHHEMTVPLTPAAAREVDVIGIF
RYKNTWPLCLEFLRSGKIDVKPLITHRFGFSQKEVEEAFETSARGGDAIKVMFNL
NT seq 1068 nt NT seq  +upstreamnt  +downstreamnt
atgggtaaaggaggaagtgatgaaaacatggctgcttggcttcttggtgttaacaccctc
aagattcagcctttcaatctccctgctttgggaccccatgatgttagagttaggatgaag
gctgttggtatttgtggaagtgatgttcactacctcaagaccttgagatgtgcggatttt
gtggttaaagagccaatggtgattggtcatgaatgtgccgggatcatagaagaagttggt
ggtgaagtcaagacgttggttcctggagatcgtgtagcactagaacccggaattagttgc
tggagatgtgatctttgcaaagaagggcgatataatctctgccctgagatgaagttcttc
gctactcctcctgttcatggttctctcgcgaatcaggtagtccatcctgcagatctatgt
ttcaagctccccgataatataagtttagaggagggagcaatgtgtgagccacttagtgtt
ggtgttcatgcctgtcggcgtgcaaatgttggtcccgagacaaatatattagtgctggga
gctggaccaattggacttgtcacactgcttgctgctcgtgcttttggcaccccaagaatt
gttattgtggatgtagatgactatcgtctttctgtcgcaaagaagttaggagcagatgac
atcgtcaaagtttcaactaatattcaggatgtagctacggatatacagaacattcagaaa
gcgatgggagttggaatcgacgtgagttttgactgtgctggctttaacaaaaccatgtcg
actgcccttggtgcaactcgtccaggcggcaaagtttgcttggtgggaatgggacatcac
gagatgaccgttcctctcactccagctgctgcaagggaggtcgatgtcatcggcatattt
cgctacaagaatacgtggccgttgtgtctcgagttcttaagaagtggaaagattgatgtg
aaaccattgatcacacacaggtttggcttctctcaaaaggaagttgaagaagcttttgaa
acaagtgctcgtggtggtgatgctatcaaagtcatgtttaatctgtaa

DBGET integrated database retrieval system