KEGG   Capsicum annuum: 107878436Help
Entry
107878436         CDS       T04646                                 

Definition
(RefSeq) phosphoenolpyruvate carboxylase-like
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
cann  Capsicum annuum
Pathway
cann00620  Pyruvate metabolism
cann00710  Carbon fixation in photosynthetic organisms
cann01100  Metabolic pathways
cann01200  Carbon metabolism
Module
cann_M00168  CAM (Crassulacean acid metabolism), dark
cann_M00170  C4-dicarboxylic acid cycle, phosphoenolpyruvate carboxykinase type
cann_M00171  C4-dicarboxylic acid cycle, NAD - malic enzyme type
cann_M00172  C4-dicarboxylic acid cycle, NADP - malic enzyme type
Brite
KEGG Orthology (KO) [BR:cann00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    107878436
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    107878436
Enzymes [BR:cann01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     107878436
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PEPcase PEPcase_2
Motif
Other DBs
NCBI-GeneID: 107878436
NCBI-ProteinID: XP_016580919
UniProt: A0A1U8HK56
LinkDB All DBs
Position
7
AA seq 954 aa AA seqDB search
MSRKIEKMASIDAQLRLLAPAKVSEDDKLVEYDALLLDRFLDILQDLHGEDIRETVQDCY
ELSAEYEGKHDPQKLEELGNMLTSLDAGDSIVVTKAFSNMLNLANLAEEVQIAYRRRSKL
KKRDFSDEASASTESDIEETLRRLVGQLKKSPEEVFDALKNQTVDLVLTAHPTQSVRRSL
LQKHARIRDCLTQLYAKDITPDDKQELDEALQREIQAAFRTDEIRRTPPTPQDEMRAGMS
YFHETIWKGVPKFLRRVDTALKNIGINERVPYNAPLIQFSSWMGGDRDGNPRVTPEVTRD
VCLLARMMAAKLYFSQIEDLMFELSMWRCNDELRARAEELHRTSKRDAKHYIEFWKQIPS
NEPYRVLLADVRDKLYNTRERARQLLANGLSDIPEEATFTNIEQFLEPLELCYRSLCACG
DRPIADGSLLDFLRQVSTFGLSLVRLDIRQESDRHTDVLDAITRHLGIGSYKEWSEEKKQ
EWLLSELSGKRPLFGPDLPKTDEIADVLDTXFGAYIISMATAPSDVLAVELLQRECHVKS
PLRVVPLFEKLADLESAPAAVARLFSIDWYRNRINGKQEVMIGYSDSGKDAGRLSAAWQL
YKAQEELVKVAKEFGVKLTMFHGRGGTVGRGGGPTHLAILSQPPDTVHGSLRVTVQGEVI
EQSFGEEHLCFRTLQRFTAATLEHGMNPPVAPKPEWRALLDEMSVVATKEYRSLVFQDPR
FVEYFRLATPELEYGRMNIGSRPAKRKPSGGIESLRAIPWIFAWTQTRFHLPVWLGFGAA
FKHVIEKDIRNLQMLKDMYNGWPFFRVTLDLIEMVFAKGDPGIAALYDKLLVSEDLWPLG
ERLRSKYEETKGYLLQVAGHKDLLEGDPYLRQRLKLRDSYITTLNVCQAYTLKRIRDPSY
NVKVGPHLDKEIVESSKPAAELVKLNPMSEYAPGLEDTLILTMKGIAAGMQNTG
NT seq 2865 nt NT seq  +upstreamnt  +downstreamnt
atgagtagaaaaatagagaaaatggcatcaattgatgcacagttgaggttattggcacca
gcaaaagtgtcagaggatgataagcttgtggaatatgatgctttgttgcttgatagattt
cttgatattctccaggatttgcatggagaggatattagagaaacggttcaagactgttat
gaactttctgctgaatacgaagggaagcatgacccacagaagttggaagagcttgggaat
atgcttaccagtttggatgctggggattccatcgtagtcaccaaagccttttctaacatg
cttaacttggcaaaccttgccgaagaggttcagatagcttacagacgaagaagtaagcta
aaaaagcgtgatttttcagatgaggcgtctgcatcaactgaatcagacattgaagagacc
cttaggaggctcgtcggacagctaaagaaatcacctgaagaagtttttgatgctttgaag
aaccagaccgtggatttggtgctaacagcacatcctactcaatctgttcgtaggtctttg
cttcaaaagcatgcaaggattcgtgattgtctgacgcagttgtatgccaaagatattact
cctgatgataagcaggagctagacgaggctctacaaagagagatacaagcagcctttcgc
acggatgaaatcagaaggactccaccaactccacaagatgagatgagggcggggatgagt
tacttccacgagacaatatggaagggggtgccgaaattcctacgccgtgttgacactgct
ttgaagaatattggaataaatgaacgcgttccctacaatgcccctctcattcagttctct
tcttggatgggtggtgatcgagatggtaaccctagagtaactcccgaagtgacaagagat
gtgtgcttattggctcgaatgatggctgcaaaactgtatttctctcagattgaggatctt
atgtttgagctgtcaatgtggcgatgcaatgatgagctccgtgcgcgtgcagaagaactt
cataggacttccaaaagagatgcaaagcactacattgaattttggaagcaaattccatca
aatgagccctaccgtgtgcttcttgctgatgtgagagataagttatataatacacgggaa
cgagctcgtcagttactagctaatgggttgtctgatattcctgaggaggccacattcaca
aatattgaacagtttctggaacctctggagctgtgttatagatctctatgcgcttgcggt
gacagaccaattgcagatggcagccttcttgattttctaaggcaagtttccacctttggt
ctctcacttgtgagacttgatatccggcaagagtcagataggcacaccgacgttctagat
gctataacaaggcacctgggtattggctcctataaagaatggtctgaagagaagaaacag
gaatggctcttatctgaactaagtggcaagcgtccactttttgggcctgatctccctaaa
actgatgaaatcgctgatgttctggatacanattttggtgcttatataatttcgatggcc
acggcaccctctgatgtgcttgccgttgagcttttgcagcgtgagtgtcatgtaaaaagt
ccattgagggttgttccgttgtttgaaaagcttgctgatcttgaatctgcacctgctgct
gttgctcggctgttctccatagattggtacagaaaccgtatcaacgggaaacaagaagtt
atgattgggtattctgattcaggtaaggatgctggccgactatctgcagcttggcaattg
tacaaggctcaagaggaacttgtaaaggtggcaaaagaatttggagtaaagttaacaatg
ttccatggccgaggagggactgttggccgaggagggggtcccacccaccttgctatttta
tcacaaccccccgacacagtccatggttcacttcgtgtgactgttcaaggtgaagttatt
gaacagtcatttggggaggaacacctgtgctttagaactcttcagcgtttcactgctgct
acacttgagcatggaatgaatccccctgtggctccaaagccagagtggcgtgccctattg
gatgagatgtctgttgttgctaccaaagagtatcggtctttagtgttccaggatccacga
tttgttgaatacttccgccttgcaaccccggaactagaatatggtcgcatgaatattgga
agtcgcccggccaaaaggaagccaagtggtgggattgaatctcttcgagctattccatgg
atctttgcatggacccagacgaggtttcatctcccagtctggcttggctttggggctgca
ttcaagcatgttattgagaaggatataagaaatctgcaaatgctcaaggatatgtacaat
ggatggcctttctttagagtgacacttgacttgattgaaatggtgtttgctaagggagac
cctggtattgctgcattgtacgataagcttttggtatcagaagatctgtggccgcttgga
gagcgcttgagatccaaatatgaagaaacaaaaggctatctccttcaggttgctgggcac
aaggatcttttggaaggagatccatacttgaggcaacggctcaaacttcgtgattcttac
attacgaccctcaatgtttgccaagcatacacattgaagagaattcgcgaccccagctac
aatgtgaaggtcgggccgcatctagacaaggaaatcgtggaatcaagcaaaccagcagct
gaattagtgaagctgaatcctatgagtgagtatgctcctggcttagaagacaccctcatc
ttgacaatgaaaggtattgctgctggtatgcagaacactggttaa

DBGET integrated database retrieval system