KEGG   Cellulophaga algicola: Celal_0182Help
Entry
Celal_0182        CDS       T01404                                 

Definition
(GenBank) superoxide dismutase copper/zinc binding protein
  KO
K04565  superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
cao  Cellulophaga algicola
Brite
Enzymes [BR:cao01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     Celal_0182
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Cu FadA DUF948 YtxH FAM176 Big_3_5 Big_1 FSAP_sig_propep
Motif
Other DBs
NCBI-ProteinID: ADV47533
UniProt: E6X7U0
LinkDB All DBs
Position
191086..191685
Genome map
AA seq 199 aa AA seqDB search
MKKLIFALTIAVISISYSCKETKKEVEETSDEIENSANEMTDDMEDTMDEKTMTISLEPK
SDSKVKGEVTFTEKDGEVMMVATLAGLSEGEHAIHIHETADCSSADGKSAGGHWNPTFQQ
HGKWGDEAGYHRGDIGNFMADADGNAKVEFSTDEWCIDCDDDTKNIIGKGVIVHQGVDDF
TSQPSGDAGARVSCAGIIQ
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaattaatatttgctctaacaattgctgtaataagtatttcttatagctgtaaa
gaaacaaagaaagaagttgaagaaacctctgatgagatagaaaacagcgcaaatgaaatg
actgatgatatggaggatactatggatgaaaaaaccatgaccatttcattagagcctaaa
agcgattctaaagtaaaaggtgaagttacttttaccgaaaaagatggtgaagtcatgatg
gtggctacattagctggattatctgaaggagaacatgctattcatattcatgaaacggca
gattgttcttctgctgatggaaaatctgcaggtggccattggaacccaacattccaacaa
catgggaaatggggtgatgaagctggataccacaggggtgatattggaaactttatggca
gatgctgatggcaatgccaaggtagaatttagtacagatgaatggtgtattgattgtgat
gatgatacaaaaaatattattggcaaaggagtaatcgttcaccaaggagttgatgatttt
acctctcaacctagtggagatgcaggtgctcgtgtaagttgtgccggtattattcaataa

DBGET integrated database retrieval system