KEGG   Cellulophaga algicola: Celal_0747Help
Entry
Celal_0747        CDS       T01404                                 

Definition
(GenBank) pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
cao  Cellulophaga algicola
Pathway
cao00010  Glycolysis / Gluconeogenesis
cao00020  Citrate cycle (TCA cycle)
cao00620  Pyruvate metabolism
cao01100  Metabolic pathways
cao01110  Biosynthesis of secondary metabolites
cao01120  Microbial metabolism in diverse environments
cao01130  Biosynthesis of antibiotics
cao01200  Carbon metabolism
Module
cao_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:cao00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Celal_0747
   00020 Citrate cycle (TCA cycle)
    Celal_0747
   00620 Pyruvate metabolism
    Celal_0747
Enzymes [BR:cao01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     Celal_0747
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 GCV_H DUF2118 PYNP_C Peptidase_M23 Monooxygenase_B
Motif
Other DBs
NCBI-ProteinID: ADV48082
UniProt: E6XE16
LinkDB All DBs
Position
complement(829458..831098)
Genome map
AA seq 546 aa AA seqDB search
MAIVINMPRLSDTMEEGTVAKWLKKVGDKVEEGDILAEIETDKATMEFESFNEGTLLHIG
IQEGDGAPVDTLLAIIGEEGEDISGLLSGGASAPEAKTEEKQEEVASEPETTDEAAASVA
IPEGVEIIKMPRLSDTMEEGTVASWLKKVGDKIEEGDILAEIETDKATMEFESFYSGTLL
YIGTQEGESSPVDVILAIIGPEGTDVDALLASKPSKPSTAAKPAATAPKEATKTEAKAAP
SAPAETQEVVVKDGQRIFVSPLAKKIASEKGVNLNDVTGSGDNGRIVKKDVENFVPAPKA
AAPAAKASSASAPLALPVGEESVEDIKNNQMRKVIAKRLGESKFTAPHYYLNIEVDMDNA
KASRVQINALPDTKVSFNDMVVKACAMALRKHPQVNTSWNGDTTRYNHHISVGVAVAVED
GLVVPVLKFTDQMGLSQIGASVRDLAGKARTKKLTPAEMEGSTFTVSNLGMFGVESFTSI
INQPNSAILSVGAIVEKPVVKDGQIVVGNTMKLTLACDHRTVDGATGAQFLQTLRAFIEN
PVTMLA
NT seq 1641 nt NT seq  +upstreamnt  +downstreamnt
atggcaatagtaataaatatgccgagacttagtgataccatggaagaaggtaccgtagct
aagtggttaaaaaaagtaggagataaagttgaagaaggtgatattttagcagaaatagaa
accgacaaagcaaccatggaatttgaatcttttaatgaaggaacgttacttcatatagga
attcaagaaggtgatggtgctcctgtagataccttactagctataattggtgaagaaggc
gaagatatttctggtttattaagtggtggtgcttcggctccagaagctaaaacagaggaa
aaacaagaagaagtagcttctgaaccagaaactactgatgaagctgcagcgtctgtagcg
attcctgaaggagtagaaatcattaaaatgccacgtttaagtgataccatggaagaaggt
acagtagcttcttggttgaaaaaagttggtgataagattgaagaaggagatattcttgct
gagatagaaacagataaagctaccatggagtttgagtctttctattcaggaacattattg
tatataggaactcaagaaggagagtcttctccagttgatgttattctagctattattggc
ccagaaggaacagatgtagatgcacttttagcatcaaaaccatcaaaaccatcaacagcg
gctaagccagctgcaacagctccaaaagaagcaactaaaacagaagcaaaagctgcgcct
agtgctccagcagaaacgcaagaagttgttgttaaagacggacaaagaatatttgtttct
ccactagctaagaaaattgcatcagaaaaaggagtaaacttaaatgatgttacaggttct
ggagataacggaagaattgtaaagaaagatgtagaaaactttgttcctgctcctaaagcg
gcagctccagcagcaaaagcttctagtgcaagtgctccattagcattgccagtgggtgaa
gaaagtgttgaagatattaagaacaaccaaatgcgtaaagttattgctaagcgtttggga
gagtctaagtttacagcaccacattactaccttaatatagaggtagacatggataatgcg
aaagcttcaagagtgcagattaatgctttgccagatacaaaagtatcatttaatgatatg
gtagtaaaggcttgtgcaatggcacttagaaagcatccacaagtaaatacatcttggaat
ggcgatacaacacgttataatcaccatattagtgttggtgttgcagttgcagtagaagat
ggtttggtagttcctgtattgaaatttacagatcaaatgggattatctcagattggtgct
tctgtaagagatttagcagggaaggctagaactaagaaattgacaccagccgagatggaa
ggtagtacatttacagtttctaacttgggtatgtttggcgttgagagttttacctcaatc
atcaatcagcctaattcagcaatcctatccgtaggagcaattgtagagaaaccagtagtt
aaagatgggcaaattgttgtgggtaataccatgaaattgacacttgcttgtgatcataga
acagtagatggtgctacaggggctcaatttttgcaaacattacgtgcattcattgagaat
ccagtgaccatgttagcttaa

DBGET integrated database retrieval system