KEGG   Cellulophaga algicola: Celal_0753Help
Entry
Celal_0753        CDS       T01404                                 

Definition
(GenBank) homodimeric glycerol 3-phosphate dehydrogenase (quinone)
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
cao  Cellulophaga algicola
Pathway
cao00564  Glycerophospholipid metabolism
cao01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cao00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    Celal_0753
Enzymes [BR:cao01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     Celal_0753
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_binding_3 FAD_binding_2 Pyr_redox_2 FAD_oxidored NAD_binding_8
Motif
Other DBs
NCBI-ProteinID: ADV48088
UniProt: E6XE22
LinkDB All DBs
Position
complement(837525..839174)
Genome map
AA seq 549 aa AA seqDB search
MKKENFTYLKRDKITEELKANTFDLVVIGGGITGAGILLDASSRGMKVALIEKGDFASGT
SSKSSKLIHGGLRYLKQFELMLVKEVGTERAIVHKLAPHLVIPEKMLLPLIEDGSYGEWM
TSIGLKVYDILADVEGDDKRKMMNKEETLALEPLLPEGILKGSGYYAEYRTDDARLTLEN
IKTALNYNATAINYTKVTDFLYDGDQISGVTVTDAVSGESYQIHSKYVINAAGPWVDELR
TINHSKEGKQLHLTKGVHLVFEKAKLPLKQSVYFDIPDGRMMFAIPRGNVTYAGTTDTNY
KHSKEDVVATVEDADYLLDAINNMFPSVHLERKDIVSSWAGLRPLIHEEGKSPSELSRKD
EIFNSDSGLLSMAGGKLTGYRKMAERVVDKVHKKLEKQTSARFKDVFTDKIPLTGGPWKK
YKEVKKYITKINDILEKDNFEAHEAWYLVTTYGKQTEAILQIYASSTGANPKENLIMAEL
EFCMHHEMVVTPLDFFIRRTGRLYFNIESVKAYREKVFAVFKETFALSEETLSAYNSELD
ALIKSHSEF
NT seq 1650 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaagaaaattttacctatttaaaaagagataagataacagaagaattaaaggct
aatacgtttgatttagtagttattggtggaggaattacaggagcaggtattttattagat
gcatcctcaagaggaatgaaagttgctttaatagaaaaaggcgattttgcttcaggaacc
agtagcaagtcttctaaattaattcatggaggtcttcggtacttaaagcaatttgagcta
atgcttgtaaaggaagtaggtacagaacgtgctatagtgcataaattagcaccacattta
gtcattcctgaaaaaatgctattaccgcttattgaagacggttcttatggagaatggatg
acttcaattggcttaaaagtttatgatattcttgctgatgtagaaggtgatgataagcgt
aaaatgatgaataaggaagaaaccttagcattagagccattattgccagaaggcatcttg
aaagggtctgggtattatgcggaatatagaacggatgatgcacgtttgactttagagaac
attaaaacggcattaaattacaatgcaacagctattaattatacgaaagtaactgacttt
ttgtatgatggcgaccaaatttcgggagtcacggttaccgatgcagtgagtggagaatct
tatcagatacattctaaatacgtaattaatgctgcgggtccgtgggtagatgagttgagg
acgatcaatcattctaaagaaggaaagcaattacatctgaccaaaggagtgcatttggtt
tttgaaaaagcgaaactacctttaaaacaatccgtttactttgatattccagatggtcgc
atgatgtttgctattcctagaggaaatgtaacttatgcaggtacaacggataccaattac
aaacattctaaggaagatgttgtggctactgtagaagatgcagattatttgttagatgct
attaataacatgtttcctagtgttcatttagagcgtaaagatattgtgtcttcttgggca
ggtttaaggcctttaatacatgaagaagggaagtcgccttcagagctatctaggaaagat
gaaatatttaattctgattctggattattgagtatggcaggaggtaagcttacggggtat
cgtaaaatggcagaacgagtagtagataaagttcacaaaaaattagaaaaacagacaagt
gcaaggttcaaggatgtttttacggataaaattccgctaactggtgggccatggaaaaaa
tacaaagaagttaagaaatacatcactaaaattaatgacatattagaaaaggataatttt
gaggcacatgaagcatggtatttggttaccacatatgggaaacaaacagaagctatatta
caaatttatgcttccagtacaggggctaatcctaaggagaatttaatcatggctgagtta
gaattttgtatgcaccatgaaatggtggttacgccattagatttttttatacggagaaca
ggaagactgtattttaatatagagagtgtaaaagcgtatagagaaaaagtttttgcagtt
tttaaagagacttttgctttaagtgaagaaaccttatcagcctataattcagaattagat
gctttgataaaatcacattcagaattctaa

DBGET integrated database retrieval system