KEGG   Cellulophaga algicola: Celal_1321Help
Entry
Celal_1321        CDS       T01404                                 

Definition
(GenBank) Thymidine kinase
  KO
K00857  thymidine kinase [EC:2.7.1.21]
Organism
cao  Cellulophaga algicola
Pathway
cao00240  Pyrimidine metabolism
cao01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cao00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    Celal_1321
Enzymes [BR:cao01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     Celal_1321
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TK
Motif
Other DBs
NCBI-ProteinID: ADV48635
UniProt: E6X837
LinkDB All DBs
Position
1534234..1534875
Genome map
AA seq 213 aa AA seqDB search
MFLENTVNPKEQFGWIEVICGSMFSGKTEELIRRLKRAQFAKQKVEIFKPQVDTRYHEEM
VVSHDANQIRSTPVPAAANIRLLADGCDVVGIDEAQFFDDEIVAVCNDLANRGIRVLVAG
LDMDFKGNPFGPMPALMATAEYVTKVHAICTRTGNLANYSFRKSTNDKLVLLGETEAYEP
LSRAAYYKAMLREKIKDIDIEAEQVKNNTNTNG
NT seq 642 nt NT seq  +upstreamnt  +downstreamnt
atgtttcttgaaaatactgtaaaccctaaagaacaatttggctggatcgaagttatctgc
ggttctatgttctctggtaagacagaggaacttatccgacgactaaagagagcccaattc
gctaagcaaaaggttgaaatttttaaacctcaggtagacacacgctatcatgaagaaatg
gtggtatcacatgatgccaaccaaatacgctctactccggtgcccgctgccgcaaatatt
cgcttgttagctgatggatgcgatgtagtaggaattgatgaagctcagttttttgatgat
gaaattgttgccgtttgtaatgatttggcaaatagaggaattcgtgttttagttgcaggt
cttgatatggattttaaaggaaacccttttggtcccatgcccgcattgatggctacagca
gaatatgttaccaaagtgcatgctatttgtacacgcactggaaatttagccaattatagc
tttagaaaatctaccaatgacaaattagtattattgggcgaaacagaagcttatgaacct
ttaagcagagctgcatattacaaagctatgctccgagaaaaaattaaagatattgatatt
gaagcggagcaagtaaaaaacaatacaaacaccaatggctaa

DBGET integrated database retrieval system