KEGG   Cellulophaga algicola: Celal_2292Help
Entry
Celal_2292        CDS       T01404                                 

Definition
(GenBank) kynureninase
  KO
K01556  kynureninase [EC:3.7.1.3]
Organism
cao  Cellulophaga algicola
Pathway
cao00380  Tryptophan metabolism
cao01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cao00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00380 Tryptophan metabolism
    Celal_2292
Enzymes [BR:cao01000]
 3. Hydrolases
  3.7  Acting on carbon-carbon bonds
   3.7.1  In ketonic substances
    3.7.1.3  kynureninase
     Celal_2292
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_5
Motif
Other DBs
NCBI-ProteinID: ADV49584
UniProt: E6X6P6
LinkDB All DBs
Position
2612494..2613762
Genome map
AA seq 422 aa AA seqDB search
MKFENSLEFAQKLDQIDPLKKYRDEFHFPEINGKPVIYFTGNSLGLQPKRTKAIVDEVMS
DWAQLAVEGHFYAEKPWWDYHERLAAPLAKVVGAKTAEVSVMNTLTVNLHLLMVSFYRPT
QKRFKIICEEKAFPSDQYMLASQVKFHGFDPKDAIVEVKKRDGEHHWRTEDVIAKINEVG
DELALVLIGGVNYYNGQVFDMENITKAGKATGAFVGWDLAHGVGNIELKLNEWNADFAAW
CSYKYMNSGPGNASGVYINEKHLNNPDIPRFEGWWGTKKETRFLMKPEFEPMENADAWQI
SNASILAVAPYLASLTMFEEVGMPALIEKRDKIVAYLEFILHEIDAEVDSSFEIITPKDR
GCQLSVLLHGQGKSLFDYLMKNGVITDWREPNVIRLAPAPFYCSYEDMYRFGQLLKKGIL
SK
NT seq 1269 nt NT seq  +upstreamnt  +downstreamnt
atgaaatttgaaaattctttggagttcgctcaaaaattagaccaaatagatccgttaaaa
aaatatagagatgaatttcattttcctgaaattaatggtaaacctgtaatttattttaca
gggaattctttgggtttacaaccaaaaagaactaaagctattgtagatgaggttatgtca
gattgggctcagcttgctgtagaggggcatttttatgcagaaaagccatggtgggactac
cacgaacgcttggcggcgccattggctaaagtagtaggggcaaagacagcagaagtttct
gtgatgaatacgcttacggtaaatctacatttgttaatggtttcgttttatagaccaaca
caaaaaaggtttaaaattatttgtgaggagaaagcttttccttcagatcaatatatgtta
gctagtcaagtaaaatttcatggatttgatcctaaggatgctattgttgaggttaaaaaa
cgcgatggagaacatcattggcgaaccgaagatgttattgctaaaattaatgaagtagga
gacgagctggcactagtattaattggcggtgtaaattattataatggtcaggtttttgac
atggaaaatattaccaaagcaggtaaagctacgggtgcttttgtgggttgggatttggcg
cacggagtgggtaatattgagttaaaattaaatgaatggaatgctgattttgcagcatgg
tgtagttacaaatacatgaatagtggtcccggaaacgcttctggagtttacattaatgaa
aaacatttaaacaatccagatattccacgttttgagggttggtggggaaccaaaaaagaa
acacgctttttaatgaagccggaatttgagcctatggaaaatgcagatgcatggcagata
agtaatgcgtcaattttagctgtagctccttatttggcatcattaactatgtttgaagaa
gtagggatgcctgctttaattgaaaaaagagataaaattgtagcgtacttagaatttata
ttacatgagattgatgctgaggtggatagtagttttgaaataattacccctaaagataga
ggttgtcaattatccgttcttctccatggtcaaggaaaatcattatttgattacttaatg
aaaaatggcgtaattacagactggagagaacctaacgttattcgtttagcaccagcacca
ttttactgttcctacgaagacatgtatcgttttggtcagttattgaaaaaaggaatttta
tctaaataa

DBGET integrated database retrieval system