KEGG   Cellulophaga algicola: Celal_2341Help
Entry
Celal_2341        CDS       T01404                                 

Definition
(GenBank) Phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
cao  Cellulophaga algicola
Pathway
cao00620  Pyruvate metabolism
cao00680  Methane metabolism
cao01100  Metabolic pathways
cao01120  Microbial metabolism in diverse environments
cao01200  Carbon metabolism
Module
cao_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:cao00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    Celal_2341
  09102 Energy metabolism
   00680 Methane metabolism
    Celal_2341
Enzymes [BR:cao01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     Celal_2341
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase DNA_primase_S
Motif
Other DBs
NCBI-ProteinID: ADV49632
UniProt: E6X7F0
LinkDB All DBs
Position
2662875..2665421
Genome map
AA seq 848 aa AA seqDB search
MKEVQRLEEFKKSVNNKFNVYNSLFLNLPYRNIENVGMVLPLMLDQCQKGLKSGQNPKEI
LEAFFENFMAIDSEKERIDFMFRIIQYVERQVVLYDSVEDAAFPKIYKHSNNLAIKDYFE
LVDKNKSWDKISDHLSNFSARLVLTAHPTQFYTPAVLDIISELRTLILEDNIDDIDITLQ
QLGLTSLINSKKPTPLDEAKNIIYILRNVYYDAVGELYAYLKSNINNSEFENYNIMKLGF
WPGGDRDGNPYVTADITNDVADELRITLMKCYYNDLKKLQQKLTFSGLQDDINKLRGSLY
TAMFNPLKRVGYQEIITPLTQIRTVLVARYHSLYIEELDYFIDKVKIFKTHFATLDIRQD
HSMHTTVITEILIRNGFIKENLEELSEKKLIDILLHEKLKLKVFDYNEDITQETIKNVLQ
LKSIQEKNGEEGCNRYIISNSEDIFSVLYVFALFRWCGWDAKKISFDIVPLFETMKGMEE
SEGIMQRLFDMPEYMAHVKQRSEKQTMMLGFSDGTKDGGYLKANWSILKTKESLSGVCAK
NNIKAIFFDGRGGPPARGGGKTHRFYAAQTKDIANNEIQLTIQGQTITSTYGTKEQFVYN
CEQLLTAGLSNSFYGDKNVITKDQRGLIEQLSELSFEKYDALKHHDKFMAYLENMSTLKY
YTKANIGSRPGKRGNKAKLELSDLRAISFVGSWSQLKQNVPGYFGLGTAIKTMKDKGRME
EVKGLYENVPVFRALMSNSMMALSKCYFELTAYMREDEEYGDFWIILKNEYDLSKEMLLE
ISGMEILMEKEAISRESIKIRENIVLPLLVIQQYALQKIGEESSFKELYEKIVTRSLYGN
INASRNSA
NT seq 2547 nt NT seq  +upstreamnt  +downstreamnt
atgaaagaagtacagcgattagaagaatttaagaagtcggtaaataataagtttaatgtt
tacaatagtttgtttttgaacttaccttatcgaaatatagaaaatgtaggtatggttctt
ccgttaatgttagaccaatgtcaaaaaggattgaaatctggacaaaatccgaaagaaatt
ttagaagctttctttgagaattttatggcgatagattcagaaaaagaacgaatcgatttt
atgtttcgtatcattcagtatgtagaacgccaagtagtattgtatgatagtgttgaggat
gcagcatttccaaaaatatataagcatagcaataacttagcgattaaggattattttgag
ttggttgataagaataaaagttgggataaaatttcagatcatttgtctaattttagtgcc
cgtttggtattaacagcacaccctacacaattttacactcctgctgttttagatattatt
tcagaattaagaacacttattttggaagataatattgatgatattgatattaccttacag
caattaggccttacttctttgattaactcaaagaagccaacacctttagatgaagctaaa
aatattatttacattttacgtaatgtctattatgatgccgtaggggagctatatgcttat
ttaaaaagcaatattaataattcagaatttgaaaattataacatcatgaaattaggcttc
tggcctggaggtgaccgtgatggtaatccatacgttaccgcagatattactaatgatgtg
gcagatgaattgcgtattactttaatgaaatgctattacaacgatttaaaaaaattacaa
cagaaacttacatttagtggtcttcaagatgatattaataaattaagaggtagtttgtat
acagcaatgtttaatccattgaaacgtgtaggctatcaagaaattataactccactaaca
cagataagaactgttttagtagcgcgttatcattctttatatatagaagagcttgattat
tttatagataaagtaaagatttttaaaacacattttgctactcttgatatccgccaggat
catagcatgcataccacagtcattacagaaatcttaataagaaatggtttcataaaagaa
aatttagaggagctttctgaaaaaaaattaatcgatattcttctacatgaaaaacttaag
ctaaaagtttttgactacaatgaggacatcacacaagaaaccattaagaacgttttacaa
ctaaaatcaattcaagaaaagaatggagaagaagggtgtaaccgttatatcatcagtaat
tctgaagatatattttctgtattatatgtatttgcattatttagatggtgtggttgggat
gctaaaaaaataagttttgatattgttcccctttttgaaactatgaaagggatggaagaa
tctgaaggaatcatgcaacgcttgtttgatatgccggaatatatggcacacgttaaacaa
cgatctgaaaagcaaacgatgatgttaggcttctctgatggaactaaagatggtgggtat
ttaaaagccaactggtctatcctcaaaactaaagaaagcttatcgggagtttgtgctaaa
aataatatcaaagcaattttctttgatggtcgtggaggcccaccagcacgtggtggaggt
aaaacacaccgtttttacgctgctcaaacaaaagatattgcgaataacgaaatccaatta
accatacaaggacaaacaattacaagtacctatggtaccaaagagcagtttgtatataat
tgtgagcagctattaacagctggcttatctaatagtttttatggcgataaaaatgtaatt
accaaagatcaaagaggccttattgagcaactttcagagttaagttttgaaaagtatgat
gcacttaaacatcacgataagtttatggcgtatttagaaaatatgagcacgcttaaatat
tatactaaagcaaacataggaagtagaccgggcaaacgtggtaataaagcaaaattagag
ctttctgatcttagagcaatatcctttgtaggttcatggagtcagttaaagcaaaacgtt
ccaggatactttggtttaggtactgcgataaagacgatgaaagacaaaggtagaatggaa
gaggtaaaaggactttatgaaaatgtgcctgtatttagagctttaatgtctaatagtatg
atggctttatctaaatgctattttgaattaacggcgtacatgagagaagacgaggaatat
ggagatttctggattattcttaaaaatgaatatgacctttctaaagagatgcttttagag
atttctggaatggaaattttaatggaaaaagaagctatttcgcgagagtctataaaaatt
cgtgagaatattgtattgccattgttagtgatacagcagtatgccttacagaaaataggt
gaagaatcttcctttaaagaactgtacgaaaaaatagtaacacgttcgctttatggaaat
attaatgcgagtcgtaactcagcataa

DBGET integrated database retrieval system