KEGG   Cellulophaga algicola: Celal_2500Help
Entry
Celal_2500        CDS       T01404                                 

Definition
(GenBank) Beta-galactosidase
  KO
K01190  beta-galactosidase [EC:3.2.1.23]
Organism
cao  Cellulophaga algicola
Pathway
cao00052  Galactose metabolism
cao00511  Other glycan degradation
cao00600  Sphingolipid metabolism
cao01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cao00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    Celal_2500
  09103 Lipid metabolism
   00600 Sphingolipid metabolism
    Celal_2500
  09107 Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    Celal_2500
Enzymes [BR:cao01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     Celal_2500
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_2_C Glyco_hydro_2_N DUF4982 Glyco_hydro_2 BetaGal_dom4_5 Invasin_D3 AARP2CN
Motif
Other DBs
NCBI-ProteinID: ADV49788
UniProt: E6X917
LinkDB All DBs
Position
complement(2879259..2881736)
Genome map
AA seq 825 aa AA seqDB search
MKALKRTPLIILFISIFISSCQENGVEVIADQDFNKDWLFIKDTVPQGEAIHLDDSTWRK
LNVPHDWAIEGPFDSKNNARNGGLPIDGIAWYRKHFTIDAKNKNKQVAIEFDGVMDNSKI
YVNGNFVGERHYGYSGFEFDITPFIKFGEDNIIAVQLAPEVLSERWYPGAGIYRNVRLKL
NEKVHIPQWGTFISTPEVTSEKATVTIKTKLKNATDKPQEIFLETTIVDASNKTMGIATE
TIDVANNSEEQLTQHMTVVNPSLWDVGKPNLYKAISRVKIKDQIVDEFETEFGIRTIEFK
KEGFFLNGKAVELNGVCMHHDLGPLGAAVNYRATERQMQIMQNMGANALRTSHNPPSPEM
LQVCDRLGIVVIDEAFDEWKEPKVPNGYSNYFDQWAEKDLRDMIKRDRNHPSVIMWSIGN
EILEQGKKDGWKIAKMLNDICHDEDDSRPTTAGFNYYPASFVNQLAAQIDVVGVNYKPAY
YGEIREQNPDMIFYGSETSSQTSTRGFYEVPQDYHVNKETNQVSSYDVTVGPPWAYAPDI
EFDAQEKNPHSLGEFIWTGFDYLGEPTPYGGRDNSTNGYWNDDWPSHASYFAPVDLVGFP
KDRFYLYQSQWTSAPMVHVLPHWNWEGKEGQTIPVYAYTNADEVELFVNGTSFGKKVKGK
DLTDVFTEYNGFKKGIYKSKYRLSWQVAYQPGSLKVVAYTNGKQVASKEIKTAGKPAKIS
LVADRNTIKADGKDLSFVSVSIEDKDGNLCPNAANLINFKVEGAGVLEAVGNGNSASLES
FQENYIKSFFGKSLAIIKGTENTGEVTITATGENLATASLIIKTE
NT seq 2478 nt NT seq  +upstreamnt  +downstreamnt
atgaaagctttaaaacgtaccccattgatcattttgttcatttccatttttatatcttcc
tgccaagagaacggcgtagaagttatagccgatcaagattttaataaagattggcttttt
attaaagatactgttcctcaaggtgaagccatacatttagatgatagtacgtggcgaaaa
ctaaatgtacctcacgactgggccattgaaggtccttttgattctaaaaataatgccaga
aatggcgggttgcctattgatggaattgcatggtacagaaaacactttaccattgacgct
aaaaataagaacaaacaagttgctattgaatttgatggggtcatggataattccaaaata
tatgtaaacggaaattttgttggagaacgtcattacgggtatagtggttttgagtttgac
atcactccgtttataaaatttggtgaagacaatattatcgcagtacaacttgctcctgaa
gttttatcagaaagatggtatcccggagccggtatttatcgcaacgtacgcttaaaatta
aatgagaaagtacatatcccgcaatggggtacatttatttcaactccagaagttacatca
gaaaaagcaacggtaacgattaaaacaaagttgaaaaatgctactgataaacctcaagag
atatttttagaaactacgattgttgatgcttccaataaaactatgggtatagctacggag
accatagatgtagcaaataattcagaggagcaattaacacaacatatgacggttgtaaat
ccaagtctttgggatgttggcaagcctaatttatataaagcaataagccgtgtaaaaata
aaagatcaaattgtagatgaatttgaaacggaatttggaattagaacgattgaatttaaa
aaagaaggtttctttttaaatggaaaagcggtagaacttaatggcgtttgtatgcatcac
gatttaggccccttaggtgctgccgtaaattacagagcaacagagcgtcaaatgcaaatt
atgcaaaatatgggtgccaatgcgctacgtacaagtcataatccaccatcaccagaaatg
ctacaagtatgtgatagattaggcattgtggttattgatgaagcttttgatgaatggaaa
gaaccaaaagttcctaatggctacagcaactattttgaccaatgggcagaaaaagatttg
cgagacatgattaagagagatcgcaatcatccctctgtaattatgtggagtattggtaat
gagattttagagcaaggtaaaaaagacggttggaaaattgccaaaatgttgaatgatatt
tgccatgatgaagatgattctagacccacaactgccggcttcaattattatcctgcttct
tttgtaaatcaattagccgctcaaatagatgttgttggggttaattacaaacctgcatat
tatggagaaatcagggaacaaaacccagatatgattttttacggatcagaaacttcatca
caaacaagtacaagaggtttttatgaagttcctcaagactaccatgtcaacaaagaaacc
aaccaagtttctagttatgatgttactgttggtccgccttgggcctatgctccagatatt
gaatttgatgcgcaagaaaaaaacccacattctttaggagaatttatatggacaggcttt
gattatttaggagaaccaaccccttatggtggtagagataattccacgaatggctattgg
aatgatgattggccttctcacgcctcttattttgctcctgtagatttagtaggcttccct
aaagaccgcttttatttataccaaagtcaatggacatcggctcctatggttcatgtttta
ccacattggaattgggaaggcaaagaaggacaaacaatcccagtttacgcttataccaat
gcagatgaagtggagttattcgtaaacggcacctcttttggaaaaaaagtaaaaggcaaa
gatctaacagacgtttttactgaatataatggctttaagaaaggtatctacaaatctaaa
tacagactatcatggcaggtggcttaccaaccaggcagcttaaaagtggttgcgtatacg
aatggaaagcaagtagcttctaaagaaataaaaacggcaggaaagcctgctaaaatttcg
ttagtagccgatagaaatacaattaaggcagatggtaaagacctttctttcgtctccgta
agcatagaagacaaagacggcaatttatgccctaatgcagctaatttgattaattttaaa
gtggaaggagcaggagtattagaagcggttggaaatggaaattctgcctcgctagaatct
tttcaggaaaactacatcaagtcattttttggtaaaagtttagcgattatcaaaggtact
gaaaacaccggagaagttactattacggcaaccggagaaaatttagctacagcaagctta
atcattaaaacagaatag

DBGET integrated database retrieval system