KEGG   Cellulophaga algicola: Celal_2520Help
Entry
Celal_2520        CDS       T01404                                 

Definition
(GenBank) L-threonine 3-dehydrogenase
Organism
cao  Cellulophaga algicola
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C AlaDh_PNT_C 2-Hacid_dh_C AdoHcyase_NAD Pyr_redox Pyr_redox_2 UDPG_MGDP_dh_N HI0933_like adh_short TrkA_N 3HCDH_N TPR_3 Pyr_redox_3
Motif
Other DBs
NCBI-ProteinID: ADV49807
UniProt: E6X9N7
LinkDB All DBs
Position
complement(2907052..2908068)
Genome map
AA seq 338 aa AA seqDB search
MKATIYEGNKTFTVIDKEIEQPSNDEVRIKVAYSGVCGTDVHIYHGMMDKRVAMPQTIGH
EMSGTIDAVGADVTGFSIGEKVVVRPLDDRKVKASDKGFNHICEELKFIGIDSPGSMQQY
WNVPAFVLHKLKAETDLKLAALIEPLSVATHDVRRSGLVKGETAVVLGGGPIGLLVAMVA
KEVGAQVIISEVNPKRIAKAKELGFDAVNPLELDLVEYVKSKTENRRADVVFEVAGVQPA
LDVMCEVAGIRGRILMVAIHGEKKPVDLFKFFWKELSLIGARVYEKEDYEKAIELITANE
LPFEQMITDVQPLTNIQQVFENIDNNPDGLKVLMDCQL
NT seq 1017 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcaaccatatacgaaggcaataaaacctttacagttattgacaaagaaattgaa
caacctagcaatgatgaagttcgaattaaagtagcgtattcaggcgtttgcggcacagat
gtgcacatttaccatggtatgatggataagcgcgttgctatgccacagactattggacat
gagatgtctggaactattgatgccgtaggtgcagatgttactggcttttctattggagaa
aaagtagttgtacgccccttagatgatagaaaagtaaaagcatctgataaaggatttaat
cacatctgtgaagaattaaaatttattggaatagacagcccgggatcaatgcaacagtat
tggaacgttcctgcttttgtacttcataaattaaaagcggagaccgatttaaaattagca
gccttaatagaacccctatctgttgccacacatgatgtgcgcagaagtggtttagtcaaa
ggagaaactgccgtagttttaggtggcggtcctattggcttattagtagccatggtcgct
aaagaagtaggtgcacaagtaattatatctgaagtaaaccctaaacgtattgcaaaagca
aaagaattggggtttgatgctgtgaatcctcttgaattagatttagtcgaatacgtaaaa
agcaagacagaaaacagacgtgcagatgtggtttttgaagtagctggcgtgcagcctgct
ttagatgtcatgtgtgaagtagcgggtataagaggaagaattttaatggtggccatccat
ggagagaaaaaaccagtagatctctttaagtttttctggaaagaactaagcttaataggc
gctcgagtatacgaaaaagaagattatgaaaaagccattgaactcatcactgcaaatgaa
ctgccatttgaacaaatgattactgatgtgcagccattaacaaacattcaacaagttttt
gaaaatatagataacaatcctgacggtttaaaagtattaatggattgtcaattataa

DBGET integrated database retrieval system