KEGG   Cellulophaga algicola: Celal_3965
Entry
Celal_3965        CDS       T01404                                 

Definition
(GenBank) hypothetical protein
  KO
K20850  iota-carrageenase [EC:3.2.1.157]
Organism
cao  Cellulophaga algicola
Brite
KEGG Orthology (KO) [BR:cao00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    Celal_3965
Enzymes [BR:cao01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.157  iota-carrageenase
     Celal_3965
SSDB
Motif
Pfam: Pectate_lyase_3
Other DBs
NCBI-ProteinID: ADV51209
UniProt: E6XD22
LinkDB
Position
4544213..4545700
AA seq 495 aa
MKVHVKSIYLASIALFAIGCSKNVEETQDLNEAAISDDLTVLKVAASRFYTAPNAAVRNN
KKNLVSDYGVNNTDTNDDSAKLDLAIKELSNSDGGVLTIPKGTYYFNKIRMRSNVHLEIE
KGTVIYPTKGLAPAQNHRIFDFANKTEDKIENASITGKGGKFIVDLRGNTSKNLIVADVG
NVNNFKISDFSIKDEKTVFASVLISFTDNGSNAWPHNGIIENISQTNAHTGYGLIQAYAA
DNVLFNNLKCTGGVTLRLETDNLAMKTANKGGVRDIFASKIKNTSGLTPVMFSPHFMENG
KVTIDDVTAIGCAYAVRVEHGFIEIFDKQNRASGEAYKNYIEGILGAGSVSELYKRNNGR
TWAVRIDNDFSEAAYNHSNPAVNGIKPGNFNNSTVSNVKVTYKNTGAKLKHLFLPYLPCS
EWSKVCKPGPSGFEYNGPSLGVTIDNTKRDNSLGNYNVNVTTSNVSGFPNNHILNVKYNT
TKVCTNGIGTITSCN
NT seq 1488 nt   +upstreamnt  +downstreamnt
atgaaagtacatgtaaaaagtatttatttagcctcaattgcgcttttcgcaataggttgc
tcaaaaaatgttgaagaaacacaagacctaaatgaagctgcaatttcagatgatctaacg
gtcttaaaagtagctgcttctagattttacacggcacctaatgctgctgttcgtaataac
aaaaagaatttagtttctgattatggagtcaataacacagacaccaatgatgatagcgct
aaattagacttagcgattaaagaattatcgaatagtgatggtggtgtattaaccattcct
aaaggaacctattactttaataaaattagaatgcgctctaatgtgcatttagaaattgaa
aaaggtacggtcatttatcctaccaaaggattagcccctgctcaaaaccacaggattttt
gattttgcgaataagaccgaagacaaaattgaaaatgcaagtattacaggtaaaggcggt
aagtttattgtagatttaagaggaaatacctcaaaaaatctaattgttgcagatgtcggt
aatgtcaataattttaaaatatctgatttttccattaaggatgaaaaaactgtatttgca
tccgtactcataagttttactgataatggaagtaatgcatggccacacaatggaatcata
gaaaatataagtcagaccaatgcacatactggttacggacttatacaagcctatgctgcg
gataatgtattatttaacaatctaaaatgtacaggaggcgtaacattacgactagaaaca
gataaccttgctatgaaaacagctaacaaaggtggtgtacgtgatatttttgcgtctaaa
attaaaaatacaagtggtttaacgcctgtaatgttttctcctcattttatggaaaacggt
aaagtaaccatagatgatgttacggctattggttgtgcgtatgctgttcgggtagagcac
ggttttatagagatttttgataaacaaaatagagctagtggcgaggcttataaaaattat
atagaaggtatcttaggcgctggttctgtatcagaattatacaaacgcaacaatggtaga
acttgggctgtacgtattgataatgattttagcgaagcggcttacaaccactctaaccca
gctgtaaatggtattaaaccaggtaattttaataattctactgttagtaatgttaaggtt
acttataaaaatactggagctaaacttaagcatttatttttaccttacttaccttgttcg
gaatggtctaaagtttgcaagccaggtccttctggttttgagtataacggaccttcttta
ggagttaccattgataataccaaaagagataacagtcttggaaattataatgtgaatgta
accacgtctaatgtttccggttttcctaataaccatattttaaatgtaaagtataatact
actaaagtatgtactaacggtattggcaccattacttcttgtaattaa

DBGET integrated database retrieval system