KEGG   Caldilinea aerophila: CLDAP_20620Help
Entry
CLDAP_20620       CDS       T01797                                 

Gene name
tdk
Definition
(GenBank) thymidine kinase
  KO
K00857  thymidine kinase [EC:2.7.1.21]
Organism
cap  Caldilinea aerophila
Pathway
cap00240  Pyrimidine metabolism
cap01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cap00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    CLDAP_20620 (tdk)
Enzymes [BR:cap01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     CLDAP_20620 (tdk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TK AAA_14 AAA_22 ThiS
Motif
Other DBs
NCBI-ProteinID: BAM00102
UniProt: I0I4B4
LinkDB All DBs
Position
complement(2580787..2581377)
Genome map
AA seq 196 aa AA seqDB search
MMHPVHPSDGRIELICGSMFSGKTEELLRRIRRAEIARKKVQLFKPAIDNRYGLVRIASH
NGLAREDAVVVACAQEIVERLEPDTEVVAIDEVQFFDEAVVEVCDHLANRGLRVIVAGLD
QDFRGEPFGPMPRLMALAEMVDKLQAICVICGAPASRTQRLIDGKPARYDDPVILVGGSE
RYEARCRACHEVPGKP
NT seq 591 nt NT seq  +upstreamnt  +downstreamnt
atgatgcatcccgttcaccccagcgatggccgcatcgagctgatctgcggctccatgttc
agcggcaaaacagaagaactcctgcgccgcattcgccgcgctgagattgcgcgcaaaaaa
gtgcaactgtttaagccggccatcgataaccgctatggcctcgtgcgcatcgcttcacat
aacggactggcacgcgaggacgccgtggtcgtggcctgcgctcaggagatcgtggaacgg
ctggagccggacaccgaggtcgttgccatcgacgaggtgcaatttttcgacgaagctgtg
gtcgaagtgtgtgaccaccttgctaaccgcggactgcgtgtgatcgtagccggcctcgac
caggacttccgcggggagccgttcggcccgatgccgcggctcatggcgctggcggaaatg
gtagataaactgcaggcgatctgtgtcatctgcggggcgccggccagccgcacgcaacgc
ctcatcgacggcaagcccgctcgctatgacgatccggtgattctggtcggcggcagtgaa
cgctacgaagcgcgctgtcgcgcctgccacgaagtgccaggcaaaccatag

DBGET integrated database retrieval system