KEGG   Caldilinea aerophila: CLDAP_21050Help
Entry
CLDAP_21050       CDS       T01797                                 

Gene name
ahpF
Definition
(GenBank) alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
cap  Caldilinea aerophila
Brite
KEGG Orthology (KO) [BR:cap00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    CLDAP_21050 (ahpF)
Enzymes [BR:cap01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     CLDAP_21050 (ahpF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 FAD_binding_2 Lycopene_cycl Pyr_redox HI0933_like DAO GIDA NAD_binding_8
Motif
Other DBs
NCBI-ProteinID: BAM00145
UniProt: I0I4F7
LinkDB All DBs
Position
2632267..2633190
Genome map
AA seq 307 aa AA seqDB search
MTERFDAVVLGGGPAGLAATAYLLYARLNVALVSPDFGGKVFYPFALRDVPHQDTVWGTN
LVYELAERVSNALQQHIPDTADIVRRLDDGAFRVKLSGGDEIESRSVVVCTGVRAQRLFV
DGEMDYWGRGLSYSAISHAPFFHGRKVAVIGGGERAMAALQILIPLAAHIDYIEARPQPV
ADRDKAEVILSHPRIDVFRGWEVQQIVGDDYVTGVDIVGMNGEVRRLPVEGVFVQFGLLP
NNSAVRDLVELDQFGHIVVDEHCATSMPGIFAAGDVTTICAEQVPISIGEGAKAGLSAWR
YVAADKL
NT seq 924 nt NT seq  +upstreamnt  +downstreamnt
atgactgaacgattcgacgccgttgtgctcggtggtggtccggccggattggccgctacc
gcttatttgctctacgcccgcctgaatgtcgccctggtcagccctgacttcggcgggaaa
gttttttacccatttgcgttgcgcgatgttcctcatcaggacacagtctggggtactaac
cttgtttatgagctggcggagcgtgtctcgaatgcgctgcaacaacacattccagacacg
gccgatattgtgaggaggcttgacgatggggcatttcgcgtgaagctcagcggcggagat
gagatagaaagtcgcagtgtcgtcgtttgtacaggtgtgcgcgcgcagcggcttttcgtc
gatggtgagatggattattggggcagagggctcagttactctgcgatttcgcatgcgccg
tttttccatggccgcaaggttgccgtgatcggcggcggcgaacgcgctatggcagcgctg
caaatcctgatccctctggctgctcatatcgactacatcgaggcgcgaccacagcctgtc
gccgatcgggataaggccgaagtgatcctgagtcacccgcgcatcgatgtctttcgcggc
tgggaggtgcaacagattgtaggcgacgactacgtcacgggggtcgacattgtcggcatg
aacggcgaagtgcgccgattgcccgtggagggggtctttgtgcaatttggattgctcccc
aacaacagtgcggtgcgcgacctggtggaattagatcagtttggccatattgtcgtcgat
gaacattgcgccaccagcatgccgggcattttcgctgccggcgatgtcaccaccatctgc
gcagagcaggtgccgatctccatcggggagggcgccaaggcaggtctctccgcctggcgc
tatgtagcggccgacaaactttga

DBGET integrated database retrieval system