KEGG   Capnocytophaga sp. H4358: CGC49_04545Help
Entry
CGC49_04545       CDS       T05519                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
caph  Capnocytophaga sp. H4358
Pathway
caph00620  Pyruvate metabolism
caph00680  Methane metabolism
caph01100  Metabolic pathways
caph01120  Microbial metabolism in diverse environments
caph01200  Carbon metabolism
Module
caph_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:caph00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    CGC49_04545
  09102 Energy metabolism
   00680 Methane metabolism
    CGC49_04545
Enzymes [BR:caph01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     CGC49_04545
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2 CDC24_OB1
Motif
Other DBs
NCBI-ProteinID: ATA72628
LinkDB All DBs
Position
1062300..1064828
Genome map
AA seq 842 aa AA seqDB search
MRNEQLTEKFRQLVENKYQIYNSLFMSLPYDKMTNIGMLLPFLYEESKIGYEQGKTPEEI
IETFFRNHTNLQTEKQKADLLFTIIQYIERQVVLFDSVEDAAFTQLHSDKDLGTILHLYE
KSVQSQKLEEVRKKMEDFAVRVVFTAHPTQFYPSSVQRILHDLRSAILQDSTNEIDMLLQ
QLGKTPFVNKDRPTPLDEATSIIYYLRYVYYDAIGELYSNLKTYFGTINPNIVQLGFWPG
GDRDGNPFVTAEITLQVAEELRINILKCYYEHLKKLRRRLSFRGIAEILTELSLSIYTAI
HEKKIISVEHILERLSKAETILKEEHNSVFLNQLLEFSDRVKIFGTHFASLDIRQDSRIH
QQVIDEITEKYAGEKAQKMTFEEKFNWLLSNNIKLSIHHFEGITKETLLSIIGIKEIQQR
NGEKGLHRYIISNSEHIKDVLNVYALFKICGYQPDEINVDIIPLFETIDGLDLSEKVMEK
LYQHPVYQEHLVHRSKSQTIMLGFSDGTKDGGYLKANWEIYETKERLTAISKKFDIKPIF
FDGRGGPPARGGGKTHDFYASQGSSIANHKIEITIQGQTITSVFGNKDQARYNFEQLLTA
GIDNEVFKNDKKDINQQERLYMKALADLSFKRYSQLKSDSMFVPYLQKMSTLQYYGRTNI
GSRPSKRGSDGEMKFEDLRAIPFVGSWAQLKQNIPGFFGLGYALSELKKQGKFESIKKLY
KSSDFFKTLILNSMMSMNKSYFPLTYYMKNHPKFGDFWNQLHEEFLLSKQLTLELTEQKI
LQEQEPLSRRSVEIREKIVLPLLSIQQYALMKIENGEGSTELYEKMVIRSLFGNINASRN
SA
NT seq 2529 nt NT seq  +upstreamnt  +downstreamnt
atgcgaaacgaacaattgaccgaaaaatttagacaacttgttgaaaataaatatcaaatc
tacaactcattgtttatgagtttaccgtatgacaagatgacgaacataggtatgcttttg
ccttttttatatgaagaaagcaaaatcggatacgagcaaggtaaaactcctgaggaaatc
atcgaaacctttttcaggaatcatactaaccttcaaactgaaaaacaaaaggcagatttg
ctgtttactatcatacaatatattgaaagacaggtagttcttttcgatagtgtagaagat
gcagcttttactcaactgcattcggataaggacttaggaaccattctacatctctatgaa
aaaagtgtccaatcacaaaaattggaagaagttagaaaaaaaatggaagatttcgcggtg
agagtggtttttacggcacacccaactcagttctaccccagttctgtgcaacgtattttg
cacgatttgcgttctgctattttgcaagactctactaatgagatagatatgctgttacaa
caattaggaaaaaccccttttgtgaataaagatcgtcctacccctttggatgaagctacc
agcatcatctactacctacggtatgtctattacgatgccatcggagaactctactccaat
ctgaaaacctatttcggaaccattaatccaaatattgttcaattaggattttggccaggt
ggcgatcgtgacggaaatccattcgttacagcagaaataacgctacaggttgctgaagaa
ttgcgtatcaatattttaaaatgctactatgagcatctaaaaaaacttagaaggagactc
agtttcagagggattgctgaaattcttaccgaattaagtctttctatttacactgccatt
cacgagaaaaaaatcatttccgtagaacacattttagagagactttcaaaggcagagacc
atattaaaagaagaacataatagtgttttcttgaatcagcttttggaatttagcgatcga
gtgaaaattttcggaacgcattttgcttcgttggacatccgacaggacagtcgtatccac
cagcaagtcattgatgaaatcacggaaaaatatgcaggagaaaaagctcaaaaaatgact
tttgaagaaaaattcaattggcttttgagtaacaacattaaattatcaatccatcatttt
gagggaattaccaaagagaccttactttccattatcggcataaaagaaatccaacaacga
aatggtgaaaaggggctccatcgttatatcatttcgaattcggaacatattaaagatgtg
ttgaatgtgtatgctcttttcaaaatttgtggataccaacctgatgaaatcaatgtcgat
attattccactatttgaaactatagatggattagatctttcagagaaggtaatggaaaaa
ctctatcaacatcctgtttatcaagagcatttagtacatcgaagtaaatcacaaactatt
atgttaggattttccgatggtacaaaagacggaggttacttaaaagcaaattgggaaatc
tacgagactaaagagcgacttacagctatttccaaaaaatttgacattaaaccgattttt
tttgacggacgcggaggcccaccagcccgaggaggcggaaaaacgcacgatttttatgct
tcgcaaggaagctctatagctaatcataaaatagaaatcaccattcaaggacaaaccatt
acgagtgtgttcggaaataaagatcaagcacgttacaatttcgaacaattgctaacagca
ggtattgataatgaagtgtttaaaaatgataaaaaggacatcaatcagcaagaacgcctc
tacatgaaagcattagcagatttgagttttaagcgatattcacagcttaaatctgattct
atgtttgtgccatatcttcagaaaatgagtacgttacagtactacggacgcactaacatt
ggaagtcgtccatcaaaaagaggtagtgatggagaaatgaaattcgaagatttacgtgct
attccatttgtaggctcatgggctcaacttaaacagaatattccaggcttttttggatta
gggtatgctttatctgaactaaaaaaacaagggaaattcgaaagtataaaaaaattatac
aaaagctcagatttctttaaaacattgattcttaactccatgatgagtatgaacaagagt
tactttccgttgacctattacatgaaaaaccatccgaaatttggtgatttttggaatcaa
ctacatgaggagtttttattgtcaaaacagctaacattggaactcacggaacaaaaaatc
ctgcaagaacaagaaccgctaagtcgtcgttcagtagaaattcgtgaaaaaatagtgttg
ccgttattaagtattcaacagtacgcacttatgaaaatagaaaatggtgaaggaagtacg
gaactctatgagaaaatggttattcgctcactgttcggaaatatcaacgcaagtagaaat
tcagcataa

DBGET integrated database retrieval system