KEGG   Capnocytophaga sp. H4358: CGC49_09595Help
Entry
CGC49_09595       CDS       T05519                                 

Definition
(GenBank) thymidine kinase
  KO
K00857  thymidine kinase [EC:2.7.1.21]
Organism
caph  Capnocytophaga sp. H4358
Pathway
caph00240  Pyrimidine metabolism
caph01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:caph00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    CGC49_09595
Enzymes [BR:caph01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     CGC49_09595
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TK AAA_22
Motif
Other DBs
NCBI-ProteinID: ATA73507
LinkDB All DBs
Position
complement(2264803..2265414)
Genome map
AA seq 203 aa AA seqDB search
MFLENTTNHSEKFGWIEVICGSMFSGKTEELIRRLRRAQFAKQKVEIFKPALDTRYDESK
VVSHNANEIHSTPVPTATHILLLADGCDVVGIDEAQFFDNEIVNVCNDLANRGVRVIVAG
LDMDFKGNPFGPMPALMATAEYVTKVHAVCTRTGNLAHFSFRTTDNDGLFVLGEKESYEP
LSRAAFFKAMKTKKDNLVENTEK
NT seq 612 nt NT seq  +upstreamnt  +downstreamnt
atgtttttagaaaacaccacaaatcattcagaaaaattcggatggatagaggtcatctgt
ggatctatgttttcggggaaaaccgaagaactcatccgtaggttgcgacgagctcaattc
gctaagcaaaaagtagagattttcaaacctgctcttgacactcgttatgacgaaagtaag
gtcgtttcacataacgctaacgaaattcattcgacccctgtaccaacagctactcatatt
ttactacttgctgatggttgtgatgtagtgggaattgatgaagcccaattttttgacaac
gaaatagtaaatgtatgtaatgatctagctaacagaggagtacgggttattgttgcaggg
ttagacatggatttcaaaggcaatccttttggtccaatgcctgcactgatggctacggct
gaatatgttacaaaagtccacgctgtttgtactcgtacaggaaatttagctcactttagt
ttccgaactactgacaatgatggtttatttgtgttaggagagaaagaaagttacgaacct
ctgagccgagccgctttttttaaggctatgaaaacaaaaaaagacaatctcgttgaaaat
accgaaaaataa

DBGET integrated database retrieval system