KEGG   Capnocytophaga sp. ChDC OS43: CBG49_06440Help
Entry
CBG49_06440       CDS       T04940                                 

Definition
(GenBank) 2-oxoglutarate dehydrogenase E1 component
  KO
K00164  2-oxoglutarate dehydrogenase E1 component [EC:1.2.4.2]
Organism
capn  Capnocytophaga sp. ChDC OS43
Pathway
capn00020  Citrate cycle (TCA cycle)
capn00310  Lysine degradation
capn01100  Metabolic pathways
capn01110  Biosynthesis of secondary metabolites
capn01120  Microbial metabolism in diverse environments
capn01130  Biosynthesis of antibiotics
capn01200  Carbon metabolism
Module
capn_M00009  Citrate cycle (TCA cycle, Krebs cycle)
capn_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:capn00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    CBG49_06440
  Amino acid metabolism
   00310 Lysine degradation
    CBG49_06440
   00380 Tryptophan metabolism
    CBG49_06440
Enzymes [BR:capn01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.2  oxoglutarate dehydrogenase (succinyl-transferring)
     CBG49_06440
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transket_pyr E1_dh OxoGdeHyase_C 2-oxogl_dehyd_N
Motif
Other DBs
NCBI-ProteinID: ASF42741
UniProt: A0A1Z4BN64
LinkDB All DBs
Position
1408914..1411688
Genome map
AA seq 924 aa AA seqDB search
MDKYSFLNAASTAFFGDLYDKYLENPDAVEPSWRAFFQGFDFAQEQYGTSVEEAIPAMAQ
QVVSDENPALINKVKKEFAVLNLINDYRTYGHLFAQINPLRPREPYTPTLAIENYGLTSA
DLNTSFDAAREIGLAPAPLSTIVEKLQATYCKSIGVDFQHIRNTEERNWFVKRLQQNHNT
PQFSKEEKLQILQKLNEAASFENFLHTKYVGQKRFSLEGNDTLVAGLDFMIEAAAEQGVK
HVVLGMAHRGRLNVLANIFHKNPQDIFSEFDGKDYEMDDWFDGDVKYHLGITTQRNTRTG
KTVDMNLVPNPSHLEAVNALVGGITRAKQDRYCQGNIRQALPILIHGDAAVAGQGIVYET
VQMCGLRGFTNGGTVHIVVNNQVGFTANFSDSRSSLYCTDIAKINESPVLHVNADDAEAV
VHTFLLAIDYRQAFGKDVYINLFGYRKYGHNEGDEPRFSQPIMYKTIGKHDNSFHMYAQK
LIGEGITQQAYVTEIENAYKAYLDTCLEASRKEPITILKPFMQTEWQGFEIASPQEMLQK
VNTTIAKEKLDQIAAVLTELPADKPFINKVKKIIADRKEAYANNHIDWGMAELLAYGSLL
TEGFDVRITGEDVQRGTFSHRHAVLKTEDTEEEVCFLKDLKTKQLATGNFHIYNSLLSEY
GVLGYEYGYAMASPRTLTIWEAQFGDFSNGAQIMIDQYISCGEGKWKTQDGLVMLLPHGF
EGQGAEHSSARIERYLQLCAENNMYVTNCTTPANFFHLLRRQMKTNFRKPLIVFTPKSLL
RHPQVISTVDDLAAGHFQEVLDDPIANAEKVKRVVFCSGRYYYDLYAEREKLGRDDVALV
RIEQLFPLPVEQLKAVIAKYAHATDFVWAQEEPKNMGAYGYMLMNFDLVKWRYVGTPAYA
APASGSHTRDRKRHSQAIAAVFIP
NT seq 2775 nt NT seq  +upstreamnt  +downstreamnt
atggataagtattctttcttgaatgccgcaagtacggcctttttcggtgatttatacgat
aaatatttagaaaaccccgatgcggtagaacctagttggcgcgctttcttccaaggtttt
gattttgctcaagagcaatatggcacttccgttgaagaagctatacccgcaatggcacaa
caagtagtgagtgacgaaaaccccgccttgatcaataaggtcaaaaaagaattcgccgtt
ctcaacctaatcaacgattatcgtacttacggacacttattcgctcaaatcaacccgcta
cgccctcgtgagccttatacccctaccttggctatcgaaaactacggactcacatccgcc
gatttaaacacctctttcgatgccgctcgcgaaataggcttagcccccgcacccctcagc
actatcgtcgaaaaactccaagctacctattgtaaatctataggagttgattttcaacac
attcgcaataccgaagaacgcaactggtttgtcaaacgattacaacaaaaccataatacc
cctcagttttctaaagaagaaaaactccaaatcctccaaaaactcaacgaagcggcttct
tttgagaacttcctacatacaaaatatgtaggtcaaaaacgtttctcattagaaggtaat
gatacccttgtagcggggcttgactttatgatcgaagcagctgccgagcaaggcgtaaaa
cacgtcgtactcggtatggcgcaccgcggtcgattgaatgtattagctaatatattccac
aaaaatccacaagatatcttctccgagttcgatggtaaagattacgaaatggacgattgg
ttcgatggcgacgtgaaataccacttgggtattaccacccagcgcaacacccgcactggc
aaaaccgttgatatgaacttagtgcctaacccctcacacctcgaagccgtaaatgcactc
gtcggagggattacccgcgctaaacaagaccgctattgtcaaggaaatatccgtcaagcc
ttgcctatactcattcacggtgatgcagccgttgcaggtcagggtatagtatacgaaact
gttcaaatgtgcggcttgcgtggctttactaatggaggtactgtacatatcgtggtcaac
aaccaagttggttttactgctaatttttccgattcacgttcttctctctactgcaccgat
attgcaaaaatcaacgaatcacctgtgcttcacgtcaatgccgatgatgccgaagccgtt
gtacatactttcctcttagcaattgattaccgtcaagcctttggcaaagatgtgtatatc
aatctctttggctatcgcaaatacggtcataatgagggcgacgaaccccgattctctcaa
ccgataatgtataaaactatcggaaaacacgataattctttccatatgtacgcacaaaaa
ctgataggggaggggattacccaacaagcgtatgttaccgaaatagaaaatgcttacaaa
gcatatctcgatacttgcctcgaagcctctcgcaaagagccgattacaatattaaaacct
tttatgcaaaccgaatggcagggctttgaaatagcctctcctcaggaaatgctacaaaag
gtaaatacaactatcgctaaagaaaaacttgaccagatagctgccgtacttaccgaatta
cccgccgataaaccctttattaataaggtgaagaaaattatcgccgaccgtaaagaagcg
tatgctaataaccatatcgattggggaatggcggaactcttagcttatggatcgctcctc
accgaaggtttcgatgtgcgcatcactggcgaagacgtacaacgtggtactttctcacat
cgccacgccgtgctcaaaactgaagatactgaagaagaagtatgtttcttaaaagactta
aaaactaaacaattagcaacaggtaatttccatatctataactccttgttatccgaatat
ggagtcttaggctatgagtatggttatgcaatggcaagtccgcgcacactcactatatgg
gaagcacagttcggcgacttctccaatggtgctcaaataatgatcgaccagtatatttct
tgtggtgaaggcaaatggaaaacccaagacggcttagtgatgttactccctcacggtttc
gaaggccagggagccgagcactcctcagcgcgcatagaacgctatttacaactctgtgcc
gaaaacaatatgtatgtaaccaattgtaccaccccagccaacttttttcacctcttgcgc
cgacagatgaaaaccaacttccgcaagcccttgatagtgttcacacctaagagcttgttg
cgtcacccacaagtgatttcaacggtagacgatttagctgcaggacatttccaagaagtg
ctcgacgaccctatcgccaatgctgaaaaggtaaaacgcgtggttttctgttccggccgt
tattactacgacctctatgccgagcgtgaaaaactcggtagagacgatgtagccttggta
cgtattgagcagttgttcccattgcctgtagagcaactcaaagcagtaattgctaaatac
gctcacgccaccgatttcgtatgggcgcaagaagaaccaaaaaatatgggcgcttatggc
tatatgctaatgaattttgatttggtaaaatggcgttatgtaggcacacctgcttatgca
gcccctgcctcaggcagtcacactcgcgaccgcaaacgtcacagccaagccattgccgcc
gtatttatcccgtag

DBGET integrated database retrieval system