KEGG   Capnocytophaga sp. ChDC OS43: CBG49_07560Help
Entry
CBG49_07560       CDS       T04940                                 

Definition
(GenBank) sialidase
  KO
K01186  sialidase-1 [EC:3.2.1.18]
Organism
capn  Capnocytophaga sp. ChDC OS43
Pathway
capn00511  Other glycan degradation
capn00600  Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:capn00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    CBG49_07560
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    CBG49_07560
Enzymes [BR:capn01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.18  exo-alpha-sialidase
     CBG49_07560
Bacterial toxins [BR:capn02042]
 Toxins that damage the extracellular matrix
  Hyaluronidases/Collagenases
   CBG49_07560
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BNR_2 BNR_3 BNR Sortilin-Vps10 BNR_assoc_N DUF4185
Motif
Other DBs
NCBI-ProteinID: ASF42938
UniProt: A0A1Z4BNT9
LinkDB All DBs
Position
1690405..1691952
Genome map
AA seq 515 aa AA seqDB search
MKQLFTIIALCFLSFGYAQKGMTFTQAQMPLATDKDNPVTSFVLPVKQGTEVKELSLQFK
SKKLNLSELSVYVGANAKREQATLFAKTSNLSCNTKLQGNFKSTNDSLFVWVSARTTQKP
DLLQKLYLSKIKLTTNEAIFTLNNAKKEGQRFAIALRQRKQDGIECYRIPGLVTTNKGTL
IAVYDNRYNNCKDLQEDIDVGMSRSTDGGQTWEPMKKVIDMGEWGGKPNRLNGVGDPAVL
VDEQTNTIWVMGLWQHGLDPQTMSWWGSKSGMTPEETGQIVVVKSEDDGKTWSEPINITS
QIKNPEWRLFFQGPGRGISMSNGTLVFAGQFKDKDQVPHSTIIYSKDHGKTWHVGTGAKT
HTTEAQVVELSDGTLMLNMRDDRNRTNYKLSDNYHGRSVAVTADMGKTWIEHNTSRTALT
EPNCMASIISYKDKKGKQYLFFSNPNDAKNRVNMTIKTSNDEGNTWDKLPSILLYEQAAM
GYSCLTVIDNKYIGILYEGDGDLLFQKIPIKEFIK
NT seq 1548 nt NT seq  +upstreamnt  +downstreamnt
atgaaacaactatttaccattattgcattatgcttccttagctttggctatgcccaaaag
ggaatgacttttactcaagcacaaatgcctttggctactgataaagataatcctgttacc
tcatttgtactgcctgtaaagcaaggaacagaggtaaaagaactctctttgcagtttaaa
agtaaaaagcttaatctatctgaactctctgtttatgtaggtgctaacgctaaaagagaa
caagcaacactttttgctaaaacttcaaatctcagttgtaacaccaaactacaaggaaat
tttaaatctactaatgatagcctttttgtttgggtttctgcccgcactactcaaaaacca
gacctcttacaaaaactctacttatcaaagataaaactcaccactaatgaggctatattc
acgctcaacaatgctaaaaaagaaggacaacgttttgctattgctcttcgtcagcgtaag
caagacggcatagaatgctaccgtataccagggcttgtaaccactaataaaggtacgctg
atagccgtttacgacaatcgttacaacaactgcaaggatttgcaagaagatatcgatgta
ggaatgagtcgtagtactgatggcggacaaacgtgggagccaatgaaaaaagtgattgat
atgggtgaatggggaggaaaacctaaccgccttaatggggtgggagatcccgcagttttg
gtagatgagcaaaccaacactatttgggtgatgggcttgtggcagcacggcttagatcct
caaacaatgagttggtggggctctaaaagtggaatgactcctgaggaaacaggacaaata
gtagtagtgaaaagtgaagacgatggcaaaacgtggagtgaacctattaatatcacctct
caaatcaaaaatcctgaatggaggctatttttccaaggacctggcagaggtatctcgatg
agtaatggtaccttggtgtttgcaggtcagtttaaagataaagaccaagtgcctcattct
actattatttacagtaaagaccacggcaagacgtggcacgtaggtacaggagctaaaaca
cacactactgaggcgcaagtggtagaactttccgatggtacactaatgctcaatatgcgc
gacgaccgcaatcgcaccaactataagctctctgataactatcacggtcgttccgtagcc
gttactgccgatatgggcaaaacgtggatagagcacaacacctctcgcactgccctcacc
gaacctaattgtatggcaagtatcatttcttataaagacaaaaagggaaaacagtattta
ttcttctctaatcctaatgatgcaaagaatagagtaaatatgactatcaaaacaagtaac
gacgaaggtaatacttgggataaactaccttcaatattgttgtatgaacaagcagctatg
ggctattcttgtcttacggtaatagataataaatacataggtattctttacgaaggtgac
ggtgatttgctcttccagaaaatacctatcaaagaatttataaaataa

DBGET integrated database retrieval system