KEGG   Caproiciproducens sp. NJN-50: EQM14_05570Help
Entry
EQM14_05570       CDS       T05807                                 

Gene name
pfkA
Definition
(GenBank) 6-phosphofructokinase
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
capr  Caproiciproducens sp. NJN-50
Pathway
capr00010  Glycolysis / Gluconeogenesis
capr00030  Pentose phosphate pathway
capr00051  Fructose and mannose metabolism
capr00052  Galactose metabolism
capr00680  Methane metabolism
capr01100  Metabolic pathways
capr01110  Biosynthesis of secondary metabolites
capr01120  Microbial metabolism in diverse environments
capr01130  Biosynthesis of antibiotics
capr01200  Carbon metabolism
capr01230  Biosynthesis of amino acids
capr03018  RNA degradation
Brite
KEGG Orthology (KO) [BR:capr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    EQM14_05570 (pfkA)
   00030 Pentose phosphate pathway
    EQM14_05570 (pfkA)
   00051 Fructose and mannose metabolism
    EQM14_05570 (pfkA)
   00052 Galactose metabolism
    EQM14_05570 (pfkA)
  09102 Energy metabolism
   00680 Methane metabolism
    EQM14_05570 (pfkA)
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    EQM14_05570 (pfkA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:capr01009]
    EQM14_05570 (pfkA)
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:capr03019]
    EQM14_05570 (pfkA)
Enzymes [BR:capr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     EQM14_05570 (pfkA)
Protein phosphatases and associated proteins [BR:capr01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     EQM14_05570 (pfkA)
Messenger RNA biogenesis [BR:capr03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     EQM14_05570 (pfkA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK NAD_kinase DAGK_cat
Motif
Other DBs
NCBI-ProteinID: QAT49290
UniProt: A0A410Q1Y1
LinkDB All DBs
Position
1171697..1172665
Genome map
AA seq 322 aa AA seqDB search
MSSKAIAVLTSGGDAPGMNAAVRAVVRTGLFYGVRVMGIQRGFNGLLSGEVVEMNLRSVS
DIIHRGGTILYTARSPEFNTPAGVQQAASTCRSLGIDGVVVIGGDGSFRGARDLTESGIR
CIGIPGTIDNDIASSEYTIGFDTAMNTAVQMVDRLRDTMESHDRCSVVQVMGRRCGDIAL
QTGIAVGATSILVPEVPYDFQKDIIDRMRFTQKTGKKHFIIIVAEGVGGVEKLARDIQEA
TGIESRATILGHVQRGGSPTLRDRVVGSAMGSLAATLLYKGKGNRVIVMRGGQIVDLDIT
EALAMKREFDMNLYEVAHRVSI
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
atgtcttcgaaggcgattgccgttttgaccagcggtggcgacgcacccggcatgaacgcc
gccgtgcgtgcggtggtccgcaccggattgttctacggtgtgagggtcatggggattcag
cgcgggttcaacggtctgctcagcggagaagtcgttgaaatgaatctgagaagcgtgtcg
gacatcattcaccgaggcggtacgattttatatacggcgcgcagcccggagttcaatacg
cccgcgggcgttcagcaggcggcttccacctgccgcagcctggggatcgacggcgtggtg
gtgatcggcggcgacggttccttccggggtgcgagggacctgacggaatcaggaatccgc
tgtatcggcattccgggaaccatcgacaatgacatcgcgtccagtgagtacaccatcggg
ttcgacacagccatgaataccgcggttcaaatggtggaccggctcagggatacaatggaa
tcccacgatcgctgcagcgttgtgcaggtgatgggccgccgctgcggagatatcgcgctg
cagacgggcattgcggtcggcgccaccagcattctggtcccggaagtcccgtacgatttt
cagaaggacattatcgaccgcatgcgctttacccagaaaaccgggaagaagcatttcatt
attatcgtcgcggaaggcgtcggcggcgtggaaaagctggcgcgggacattcaggaggcg
accggcattgaatccagggcaaccatcctgggccacgttcagcgcggcggctccccgact
ctgcgcgaccgcgtggtcggcagcgcgatgggttcccttgctgccaccctgctgtacaag
ggcaagggcaaccgcgtgattgtaatgcggggcggccagatcgtcgacctggatatcacg
gaggcgctggcaatgaagcgcgagttcgatatgaatctgtacgaagtcgcacaccgggtt
tccatctga

DBGET integrated database retrieval system