KEGG   Caproiciproducens sp. NJN-50: EQM14_11350Help
Entry
EQM14_11350       CDS       T05807                                 

Definition
(GenBank) NAD(P)-dependent alcohol dehydrogenase
  KO
K00008  L-iditol 2-dehydrogenase [EC:1.1.1.14]
Organism
capr  Caproiciproducens sp. NJN-50
Pathway
capr00040  Pentose and glucuronate interconversions
capr00051  Fructose and mannose metabolism
capr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:capr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    EQM14_11350
   00051 Fructose and mannose metabolism
    EQM14_11350
Enzymes [BR:capr01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.14  L-iditol 2-dehydrogenase
     EQM14_11350
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_zinc_N_2 UDPG_MGDP_dh_N NAD_binding_3
Motif
Other DBs
NCBI-ProteinID: QAT50306
UniProt: A0A410Q4W8
LinkDB All DBs
Position
2348377..2349426
Genome map
AA seq 349 aa AA seqDB search
MQGKMKVAVMNGIGNMGFVERDIPRLADNEVLVKLEYVGICGSDLHYYENGRIGDYIVKP
PFVLGHEPGGTVVETGKNVRHLKIGDRVALEPGKTCGHCEFCKTGRYNLCPDVIFFATPP
VDGVFQEYVAHEAGLCFKLPDNVSTMEGALIEPMAVGFHAANQGGAHAEQTAVVTGAGCI
GLVTMMALKAEGVSKVYVVDIMQKRLDKALELGADGVINGMEQDAVKAVLDLTDGNGCDL
VIETAGAEKTTQQAVHMTKKGATIVCVGYNATGMVNLPMSLALDKELTIKTVFRYRHIYP
MAIEAVAAGKVNLKGVVTNIFNFDDIQNAMDSSVRNKEDIVKAVVKIIK
NT seq 1050 nt NT seq  +upstreamnt  +downstreamnt
atgcaaggtaaaatgaaagtcgcagtgatgaacggaatcggtaacatggggtttgtcgag
agggatatcccccgtctggcagacaacgaagtccttgtcaagctggagtatgtgggcatc
tgcggctcggacctgcactactacgaaaacggccgtatcggtgattatatcgtaaaaccg
ccgttcgtgctcggccatgaacccggcggcacggtggtggaaaccggcaaaaacgtcagg
cacctgaagatcggcgacagagtcgcgctggagccgggcaagacctgcggccactgcgag
ttttgcaagacgggccggtacaatctctgtccggacgtcatcttctttgcgacgccgccc
gtcgacggggtttttcaggaatatgtcgcgcacgaggcgggcctctgctttaagctgccg
gacaacgtaagtactatggaaggcgcgctgatcgagccgatggcggtcggattccacgcg
gcgaaccagggcggcgcgcacgcggaacaaacggccgtcgtaaccggggcggggtgtatc
gggctggtcaccatgatggctctgaaagccgaaggggtttctaaggtctatgtggtcgac
atcatgcagaagcggctggacaaagcccttgagctcggcgccgacggagtgataaacgga
atggaacaagacgcggtcaaagccgtgctggatctgacggacgggaacggctgcgatctg
gtcattgaaacggcgggggcggaaaagacgacgcagcaggcagtacatatgacgaaaaaa
ggcgccacgatcgtctgcgtgggctacaacgcaaccggaatggtcaatctgccgatgagc
ctggctctcgacaaagagctgaccatcaaaacagttttccgctacaggcatatctacccc
atggcaatcgaggcggtcgcggcggggaaggtcaatctgaagggagtcgtgaccaacatc
ttcaatttcgacgacatccagaacgcgatggattccagcgtacgcaacaaggaagacatt
gtcaaagcagttgtaaagattattaagtag

DBGET integrated database retrieval system