KEGG   Caproiciproducens sp. NJN-50: EQM14_11480Help
Entry
EQM14_11480       CDS       T05807                                 

Definition
(GenBank) alcohol dehydrogenase
Organism
capr  Caproiciproducens sp. NJN-50
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2 Shikimate_DH ELFV_dehydrog AdoHcyase_NAD FAD_oxidored ADH_N_2 2-Hacid_dh_C
Motif
Other DBs
NCBI-ProteinID: QAT50331
UniProt: A0A410Q4W2
LinkDB All DBs
Position
complement(2375566..2376597)
Genome map
AA seq 343 aa AA seqDB search
MAFTKIATLVEPEKIIMSEIAVPEPKDDEVLIKISYVGICGSDIHAYFGQHPFISCPIVM
GHEFSGTVVKIGSGVKGIAVGDKVTAMPQVFCKECEPCREGRYNICDTLKVLGCQTPGAA
CEYYAVGAELVKVVNGKLPLDLAATVEPAAVGLHAVRRAGSVAGKNVVVLGAGTIGNLAA
QSAMAEGAKSVLISDLSDYRLGVAKECGIPFAVNSGKEDLGEAIRGYFRGEGADLFVECV
GIGATVNQAISLSKKGNDIVVVGVFGKTPEINMSFVQDRELRLMGSLMYVEKDWDDVTEY
LGTGRMNTRPLITRVFPFDEYFDAFKYIKANSEKSMKILTKVD
NT seq 1032 nt NT seq  +upstreamnt  +downstreamnt
atggcatttacgaaaattgcaacattggttgaacctgaaaaaatcataatgtcggaaatt
gcagtgccggaaccgaaggatgacgaagtgctgattaaaataagctatgtcggaatctgt
gggtcagatatccacgcatattttgggcagcatccgtttatttcctgtcccatcgtcatg
ggccacgaattctccggcacggtcgtgaaaattggcagcggggtaaagggcattgccgtg
ggggacaaagtcacggcaatgccgcaggtgttctgcaaagaatgcgagccctgccgcgaa
ggccgctacaatatctgtgacacactgaaagtgctcggctgccagacacccggcgcggcc
tgcgaatattatgcggtcggcgcagagctggtgaaagtcgtcaacggcaagctgccgctg
gacctggccgcgacagtcgagcccgcggcggtcggcctgcacgcggtccgccgcgccggg
agcgtagccggaaagaatgtcgtcgttctgggtgccggcaccatcggaaacctcgcggcg
caatcggccatggcggagggagcgaaatccgtgcttatttcggacctgtccgactatagg
ctgggcgtcgcaaaggaatgcggcattccgtttgccgtcaactctggcaaagaggacttg
ggcgaggcgatccgcgggtatttcaggggagaaggcgccgatttgtttgttgagtgtgtc
ggaatcggcgccaccgtcaaccaggcaatcagcctttccaagaaaggcaacgacattgtg
gtcgtgggcgttttcggcaagaccccggagatcaacatgtcgttcgtacaggaccgcgag
ttgcgcctgatgggctcactgatgtacgtcgaaaaggactgggatgacgtcaccgaatac
ctaggcacgggcaggatgaacacaaggccgctgattacgagggtattcccgttcgacgag
tatttcgatgcgttcaaatatattaaggcaaactcggaaaagagcatgaagattctgacc
aaggtagactga

DBGET integrated database retrieval system