KEGG   Candidatus Paracaedimonas acanthamoebae: IM40_05495Help
Entry
IM40_05495        CDS       T03240                                 

Definition
(GenBank) glutathione S-transferase
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
caq  Candidatus Paracaedimonas acanthamoebae
Pathway
caq00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:caq00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    IM40_05495
Enzymes [BR:caq01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     IM40_05495
Transporters [BR:caq02000]
 Other Transporters
  Pores ion channels [TC:1]
   IM40_05495
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N_3 GST_N_2 GST_N GST_C GST_C_3 GST_C_2 GST_N_4 Tom37 Glutaredoxin DUF3572
Motif
Other DBs
NCBI-ProteinID: AIL13083
UniProt: A0A077C5E7
LinkDB All DBs
Position
1054214..1054882
Genome map
AA seq 222 aa AA seqDB search
MRTLFHVPLCPFSRKVRLTLAEKKLDVNLEPELIWKKREEFLEVNPAGKVPVLIDLNQKI
LCDSNSICEYLDEAYPEPSLIGRDLFQRAETRRLIAWFDDKFNQEVTRTIVYEKTLKRFF
EQTGPDSNALRAGKAAIEFHLDYISWLIDRRNWLAGDDLSLADLTAAAHLSCVDFLGHVP
WDKFPDAKEWYSRLKCRPSFRSLLTDKMPGISVASHYSDLDF
NT seq 669 nt NT seq  +upstreamnt  +downstreamnt
atgcgtacactttttcatgtgcctttatgccctttttctcgaaaggttcgtttaactctt
gctgaaaaaaaacttgatgtaaacttagaaccagaacttatttggaagaaacgagaagaa
tttctagaggttaaccctgctggaaaagttcctgtgttaattgaccttaatcagaaaatc
ttatgtgatagcaactcaatatgtgaatatctcgatgaagcttatcctgaaccatcatta
ataggaagagatcttttccaaagagcagaaactcgcaggttgattgcttggtttgatgac
aagtttaatcaagaagttacacgcactattgtttatgagaagacattaaaacgatttttt
gaacaaactggtccagattctaatgctttacgggccggtaaagctgccattgagtttcat
cttgattacatttcatggcttattgatcgccgtaattggctcgctggtgatgacttatcg
cttgctgatcttacagcggcagctcatctttcatgtgttgactttcttggacatgttcct
tgggataaatttccagatgctaaagaatggtatagtcgcctcaagtgccgcccaagtttt
cgttcacttctcactgacaaaatgcctggaattagtgttgcttctcattattcagattta
gatttttaa

DBGET integrated database retrieval system