KEGG   Corynebacterium aquilae: CAQU_00135Help
Entry
CAQU_00135        CDS       T05112                                 

Definition
(GenBank) serine/threonine protein kinase
  KO
K12132  eukaryotic-like serine/threonine-protein kinase [EC:2.7.11.1]
Organism
caqu  Corynebacterium aquilae
Brite
KEGG Orthology (KO) [BR:caqu00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:caqu01001]
    CAQU_00135
Enzymes [BR:caqu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     CAQU_00135
Protein kinases [BR:caqu01001]
 Serine/threonine kinases: Other
  Bacterial family
   CAQU_00135
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PASTA Pkinase Pkinase_Tyr Pkinase_fungal APH Kinase-like Pex14_N Cpn10 Seadorna_VP7 Kdo DUF2076
Motif
Other DBs
NCBI-ProteinID: APT83761
UniProt: A0A1L7CD45
LinkDB All DBs
Position
complement(31768..33816)
Genome map
AA seq 682 aa AA seqDB search
MILSDRYELGEVIGTGGMADVYAATDTLLGRGVAVKMMRAELARDTGFRERFRREGQNAG
RLNHPNIVQVYDTGEVELHGVMVPYIVMERVHGRTLRDIVREDGPLKPSEAAKVLLPVCD
ALQTSHDAGIIHRDIKPANIMITNTGGVKVMDFGIARAVDDNTSAMTQTSAVIGTAQYLS
PEQARGRTASPSSDVYALGCVFYEAITGRPPFEGESPFAVAFQHVHEEPTPPSSFIPGLT
PQAAVNVDAVTLTAMAKHVGDRYQSAAQFGEDLGRISRNAVSQAAKVHLAQPKRDGADDA
PTTVVPAVGAHRPPTAATRVDQPAPQQRPAQVPPQQPAYAPQQGYPQAMPASQQPLLEKR
GGSGVGVWLASIFGIALLAGGGLFAYDYYKTSSPASSSSTTEANITVPDVSTLSAQAAED
NLRGLGLTVELKEQADPEVAKGMVISTSPAAGSQLPKGSQIIVLVSSGKEVTEVPDVRDK
TTEAARKALQDAGLELDSTVKEQASDDVPKGKVIEQSPPPGTQASKGTKVVITVSTGKDM
VRVPVITGMKWDNAEGNLTSLGFVPKVEMVDNDAPEGTVISIESEGQELPKGSDVRVEVS
KGSQVTAPDLAGMTTTKALAALRAAGWVGADDDLRVEEEPTGGLINQGKIASQDPPAGSP
LTKTDPVTVRVYVFDPLLFGER
NT seq 2049 nt NT seq  +upstreamnt  +downstreamnt
atgatcttgtctgacaggtatgagctgggcgaggttattggtaccggcggcatggccgac
gtgtatgcggcaacggatacgctgttgggccgtggtgttgcggtgaagatgatgcgcgcg
gaattggcgcgcgatacgggtttccgtgagcgttttcgccgggagggccagaatgctggc
cggttgaatcacccgaacattgtgcaggtgtatgacaccggtgaggtggaactgcacggg
gtgatggttccctacattgtgatggagcgggtgcatgggcggacgttgcgtgacattgtg
cgtgaggatggtccgttaaagccgagcgaggcggctaaggtgctgcttccggtgtgcgat
gcgttgcagacttcccatgatgcggggattattcaccgcgatatcaagccggcaaacatc
atgatcaccaacaccggtggtgtgaaggtgatggatttcggtattgcgcgggcggtcgat
gacaatacgtctgcgatgacgcagacgtctgcggtgattggtacggcgcagtatttgtcc
ccggagcaggcgcgcggccgcacggcgagcccttcctcggatgtgtatgcgctgggttgt
gttttttatgaggcgattactggtcgcccgccgtttgagggggagtctcctttcgcggtg
gcgttccagcatgtgcatgaggagccaaccccgccgtcgtcgtttattccgggtctcacg
ccgcaggctgcggtgaatgtggatgcggtgacgttgacggcgatggcgaagcatgtgggg
gatcgttatcagtccgcggcccagtttggggaggatttgggccggatttcccgcaatgcg
gtctcgcaggcagcgaaggtgcatttggcgcagccgaagcgtgatggtgctgatgatgcg
ccgacgacggtggttccggccgtgggtgcgcatcgcccgccgacggcagctacgcgggtg
gatcagcccgccccgcagcagcggccggcccaggtgcctccgcagcagccggcgtacgcg
ccgcagcagggctatccgcaggcgatgccggccagccagcagccactgttggaaaagcgc
ggcggtagtggtgtcggtgtgtggttggccagcattttcggcatcgcgttgttggccggc
ggcggcttgttcgcctacgactattacaagacgtcttcgccggcatcgtcgtcgtcgacg
acggaggccaatatcaccgttccggatgtctccacgctctcggcgcaggccgcggaggat
aacttgcggggcttgggcttgacggtggagttgaaggagcaggctgaccctgaggtagcc
aagggcatggtgatttcaacgtcgccggctgctggttcccagttgccgaagggcagccag
atcattgtgttggtgtcttccggtaaggaggtcactgaggttcctgacgtgcgtgataag
accacggaggcggcgcgtaaggcgctgcaggatgctggtttggagttggatagcaccgtt
aaggagcaggccagcgatgatgtgccgaagggcaaggtgattgagcagtcgccgccgccg
ggcacgcaggccagtaagggcaccaaggtggtgatcacggtgtcgacgggcaaggatatg
gtccgggttccggtgatcactggcatgaagtgggataacgccgagggcaatctgacttct
ttgggttttgttcccaaggtggaaatggtcgataacgatgccccggagggcacggtgatt
tccattgagtctgagggccaggagttgccgaagggttctgatgtccgcgtggaggtctcg
aagggctcccaggtcactgctcccgatttggcgggtatgaccacgacgaaggcgttggcg
gcgttgcgtgctgccggctgggttggtgctgatgatgatctgcgcgtggaggaagagccg
actggtgggttgatcaatcagggcaagattgcctcccaggatccgccggctggttcgccg
ttgacgaagactgatccggtgacagttcgggtgtatgtttttgacccgctgctgtttggt
gagcgttag

DBGET integrated database retrieval system