KEGG   Corynebacterium aquilae: CAQU_01705Help
Entry
CAQU_01705        CDS       T05112                                 

Definition
(GenBank) elongation factor Tu
  KO
K02358  elongation factor Tu
Organism
caqu  Corynebacterium aquilae
Brite
KEGG Orthology (KO) [BR:caqu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:caqu03012]
    CAQU_01705
   03029 Mitochondrial biogenesis [BR:caqu03029]
    CAQU_01705
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:caqu04147]
    CAQU_01705
Translation factors [BR:caqu03012]
 Eukaryotic Type
  Elongation factors
   CAQU_01705
 Prokaryotic Type
   CAQU_01705
Mitochondrial biogenesis [BR:caqu03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    CAQU_01705
Exosome [BR:caqu04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   CAQU_01705
  Exosomal proteins of breast cancer cells
   CAQU_01705
  Exosomal proteins of colorectal cancer cells
   CAQU_01705
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_EFTU GTP_EFTU_D3 GTP_EFTU_D2 MMR_HSR1
Motif
Other DBs
NCBI-ProteinID: APT83997
UniProt: A0A1L7CDT5
LinkDB All DBs
Position
388769..389962
Genome map
AA seq 397 aa AA seqDB search
MAKAKFERTKPHVNIGTIGHVDHGKTTLTAAITKVLADEYPDLNQAFAFDSIDKAPEEKE
RGITINISHVEYQTEKRHYAHVDAPGHADYIKNMITGAAQMDGAILVVAATDGPMPQTRE
HVLLARQVGVPYILVALNKCDSPDVDEEMIELVEMEVREMLAEQDFDEEAPIIQVSALKA
LEGDPEWTAKIVELMQACDDSIPDPVRETDKPFLMPIEDIFTITGRGTVVTGRVERGQLN
VNDEVEILGIREKSTKTTVTGIEMFRKLLDYTEAGDNCGLLLRGIKREDVERGQIVAAPG
AYTPHTEFEGSVYILSKDEGGRHTPFFDNYRPQFYFRTTDVTGVVKLPEGTEMVMPGDNV
DMSVTLIQPVAMDEGLRFAIREGGRTVGAGRVTKIIK
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
gtggcaaaggcgaagttcgagcgtacaaagccgcacgtcaacattggtaccattggtcac
gtcgaccacggtaagaccactctgaccgcagccatcaccaaggttctggctgacgaatac
ccggatctcaaccaggctttcgccttcgactccatcgataaggcaccggaggagaaggag
cgtggcatcacgatcaacatctcccacgttgagtaccagactgagaagcgtcactacgct
cacgtcgatgctcccggccacgccgactacatcaagaacatgatcaccggcgctgctcag
atggacggcgctatcctcgtggtcgccgctaccgacggcccgatgccgcagacccgtgag
cacgttctgcttgctcgccaggttggcgttccctacatcctcgtcgctctgaacaagtgt
gactccccggatgtcgacgaagagatgatcgagctcgtcgagatggaagttcgcgagatg
ctcgcagagcaggacttcgacgaagaggctcccatcatccaggtttccgctctcaaggct
cttgagggtgacccggagtggaccgctaagatcgttgagctcatgcaggcttgcgacgac
tccatcccggatccggtccgtgagaccgacaagccgttcctgatgccgatcgaggacatc
ttcaccattaccggtcgtggcaccgtcgttaccggtcgtgttgagcgcggccagctgaac
gtcaacgacgaggtcgagatcctcggtatccgcgagaagtccaccaagaccaccgttacc
ggtatcgagatgttccgcaagctgctcgactacaccgaggctggcgacaactgtggtctg
ctgctccgtggtatcaagcgtgaggacgtcgagcgcggccagatcgttgctgctccgggc
gcatacaccccccacaccgagttcgagggctccgtctacatcctgtccaaggatgagggc
ggccgccacaccccgttcttcgacaactaccgtccgcagttctacttccgcaccaccgac
gttaccggtgttgtgaagctgcctgagggcaccgagatggttatgcctggcgacaacgtc
gacatgtccgtcaccctgatccagcccgtcgctatggacgagggcctgcgcttcgctatc
cgtgagggtggccgcaccgtgggcgccggccgtgttaccaagatcatcaagtaa

DBGET integrated database retrieval system