KEGG   Corynebacterium aquilae: CAQU_06735Help
Entry
CAQU_06735        CDS       T05112                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
caqu  Corynebacterium aquilae
Pathway
caqu00620  Pyruvate metabolism
caqu00680  Methane metabolism
caqu01100  Metabolic pathways
caqu01120  Microbial metabolism in diverse environments
caqu01200  Carbon metabolism
Module
caqu_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:caqu00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    CAQU_06735
  Energy metabolism
   00680 Methane metabolism
    CAQU_06735
Enzymes [BR:caqu01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     CAQU_06735
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2
Motif
Other DBs
NCBI-ProteinID: APT84810
UniProt: A0A1L7CG11
LinkDB All DBs
Position
complement(1561264..1564014)
Genome map
AA seq 916 aa AA seqDB search
MHDLFREDIRLLGRILGDTIREQEGDDTFNLVETARRTSFAIARGDADISELQQLFNNLE
PQAMLPVVRAFSHFALLVNVVEDLHDYEAAQRALDEGQPAPNSSLEATATKLAQSEVPAH
HVADIMRHAEVAPVLTAHPTETRRRTVFDAQAHILELLAKRHEILAKPHGARTDKHLADI
EKDMRRRISMLLQTALIRVARPRIEDEVDVGLRYYTLSLLEQIPAINHDVAVMLEKLYGK
DIPRTPMIQPGSWIGGDHDGNPYVTADTLTYATTRAADTVLTFYIEQLHALEHELSLSDR
LTNPTVELVALATKGHDDVPSRVDEPYRRAVHGLRGRMNATKAQALGDTAVEGTWYRVHE
PYNSAEEFANDLAIIDHSLRHNHDGLIADDRLARIRSAVDSFGFHLYSMDLRQNSDSFEQ
TLGEVFATAGVCQNYAALGEEDKIALLSRELLSPRPLIPRIHAPFSEAVERELGIFRTAS
QLVNTFGPRMIPHVIISMATSVSDILEPMVLAKEFGMISVDGTRLRGDIDIIPLFETIDD
LAAGADILRALWSVEVYRDYLEQRNNLQEVMLGYSDSNKDGGYLAANWALYDAELAIVAA
CRDNDVRLRFFHGRGGTVGRGGGPTYDAILAQPEGAVRGAVRVTEQGEIISAKYGDPLSA
RKNLEALVAATLEASLLSVNDLTDPERAYRIVAEIAEASRQVYSNLMHEDPGFIEYFTTS
TPLQEIGSLNIGSRPASRKQTNSISDLRAIPWVLSWSQSRAMLPGWFGVGTAIKQWVGDD
ATRLEELQTLNRTWPFFSSVMSNMAQVMSKADMNVSGLYSTLVADVDTRERIFGKIAEEY
ELTKDMFFAVTGAESLLEDNPMLARSVRTRYPYLLPLNVIQLELLRRYRAGDEREIVSTG
IRLTMNGLATALRNSG
NT seq 2751 nt NT seq  +upstreamnt  +downstreamnt
atgcacgacctattccgcgaagacattcgactcctgggccgcatcctcggcgacaccatc
cgtgaacaagaaggcgacgacaccttcaacctcgtcgaaaccgcccgccgcaccagcttc
gccatcgcccgcggtgacgccgacatctccgagctgcaacaactattcaacaacctcgaa
ccccaagccatgctgcccgtggttcgtgccttctcccacttcgcgctcctagttaacgtc
gtcgaagacctccacgactacgaagcagcccaacgggccctcgacgaagggcagccggcc
cccaactcctccttggaagccaccgccacaaaacttgcccaatccgaggtgcccgcccac
cacgtcgccgacatcatgcgccacgcagaagtcgccccagtgctcaccgcacaccccacc
gaaacgcggcgccgtaccgtcttcgacgcccaagcccacatcctggaactattggccaaa
cgccacgaaatcctggccaaaccgcacggcgcccgcaccgacaaacacctcgccgacatc
gaaaaagacatgcgccggcgaatctccatgctgctccaaacagcactgatccgtgtcgcc
cggccccgtatcgaagacgaagtcgacgtcgggctgcgctactacacgcttagcctgctc
gaacaaatccccgcgatcaaccatgacgtcgccgtcatgctggaaaaactttacggcaaa
gacatcccgcgcacccccatgatccagcctggaagctggatcggtggcgaccacgacggc
aacccctacgtcaccgccgacaccctcacctacgccaccacccgcgcggcagacaccgtc
ctcaccttctacatcgagcaactccacgccctagaacacgaactcagcctctcggaccgg
ctaaccaaccccacagtcgaactggtcgccttggccaccaaaggacacgacgacgttccc
agccgagtcgacgagccctaccggcgggcagtgcatggcctgcggggcagaatgaacgcc
accaaagcccaagcgctcggcgacaccgccgtcgaaggcacctggtaccgcgtccacgag
ccctacaacagcgcggaagaattcgccaacgacctcgccatcatcgaccactccctgcga
cacaaccacgacgggctgattgcagacgaccgactcgcccgaatccgttccgcagtcgac
agtttcggcttccacctgtactcgatggatctgcgccaaaactccgactcctttgaacaa
accctgggtgaagtattcgccacagccggggtctgccaaaactatgcagcactaggggag
gaggacaagatcgcactgttgagcagggagctgctcagcccccgcccgcttatcccgcgg
atacacgccccgttcagcgaggccgtggagcgcgaactcggaatcttccgcaccgccagc
cagctcgttaacaccttcgggccccgcatgatcccacacgtcatcatctcgatggccacc
tccgtgtccgacattctcgagccgatggtgctggccaaagaattcggcatgatcagcgtc
gacggcacccgcctgcgcggcgacatcgacatcatccccctatttgaaaccatcgacgac
cttgccgccggcgcagatattttgcgcgcgctctggtccgttgaggtttaccgcgactac
ctggagcagcgcaacaacctgcaagaggtgatgttgggatactccgactccaacaaggac
ggcggatacctggccgccaactgggcgctctacgacgcggaactggccatcgtcgcagcc
tgccgggataacgatgtgcggctgcgtttcttccacggccgtggcggcaccgtcggccga
ggtggcgggcccacctacgacgccatcctcgcccaaccggaaggggctgtgcggggcgca
gtgcgcgtcaccgaacaaggtgaaatcatctccgccaaatacggcgaccctctttctgcg
cgcaaaaacctcgaagcgctcgttgccgccaccctggaagcatcactgctgtcggtcaac
gatctcaccgaccctgagcgggcctaccgcatcgtcgcggagatcgccgaagcatcgcgc
caggtctacagcaacctcatgcatgaagaccctggtttcatcgagtacttcacgacttca
acgccgctgcaagagatcggatcactgaacatcggctcccggccggcgtcgcgcaagcag
accaacagcatctccgatctgcgcgccatcccctgggtgctgtcgtggtcgcaatctcgc
gccatgctgcccggctggttcggtgtcggcaccgccatcaaacagtgggtcggcgacgac
gccacccgcctggaagagctgcaaacactcaaccgcacctggccatttttcagctccgtg
atgtcgaacatggcccaggtgatgagcaaagcagacatgaacgtctctgggctgtacagc
accctggttgccgacgtggacacccgtgaacgaatcttcggcaaaatcgcggaagaatac
gagctgaccaaggacatgttcttcgccgttactggcgccgaaagtctcctggaggacaac
ccgatgctggcgcgtagcgtgcgaactcgctacccctacctgttgcccctgaacgtcatc
cagctggaattgctgcgccgctaccgcgccggagacgaacgggagattgtgtccaccggt
attcgactcaccatgaacggtttggcgacggcgctacgcaacagcggatag

DBGET integrated database retrieval system