KEGG   Carnobacterium sp. CP1: NY10_1769Help
Entry
NY10_1769         CDS       T04230                                 

Definition
(GenBank) Cytoplasmic alpha-amylase
  KO
K01176  alpha-amylase [EC:3.2.1.1]
Organism
carc  Carnobacterium sp. CP1
Pathway
carc00500  Starch and sucrose metabolism
carc01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:carc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    NY10_1769
Enzymes [BR:carc01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     NY10_1769
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alpha-amylase Glyco_hydro_70 DUF1939 Xylo_C
Motif
Other DBs
NCBI-ProteinID: ALV22367
UniProt: A0A0U3MPD7
LinkDB All DBs
Position
1829554..1831041
Genome map
AA seq 495 aa AA seqDB search
MKENGIMMQYFEWHLEADGKHWERLKADAEHLSKMGVTGVWIPPCFKATGINDVGYGIYD
LYDLGEFDQKDAIRTKYGTKKELKAAVDELHKYDIQVYADIVLNHKAGADETERFMASEV
NPDDRNQTISEPYEIEGWTKFTFPGRKGTYSDFQWSWVHFSGIDYNQENGKKAIYRIEGE
NKGWANDDKVNNEYGNYDYLMYADIDYAHPGVIEETKKWAKWFIEETGVDGFRLDAVKHI
NENFIYDLVKTIRNEFGEQFFVVGEYWDSAYESVEGYLEDQDFNLALVDVGLHTNLEQAS
KSGNEYDLCQLFDATLMKKNSSYSVTFVDNHDSQPGQSLESFVESWFKPLAYGVILLRAE
GYPCLFYGDYYGIQGENPIAPQQEMIDKLLYIRTHHAYGEQVDYFDHPNCIGWTRLGNEQ
HPYGCAVVLSNGEAGYKEMQMGKQHAGETFADYTGNHEEKVVIDENGNGYFLVQAGSISV
WAKEGVKPEEAAEEK
NT seq 1488 nt NT seq  +upstreamnt  +downstreamnt
atgaaagagaatgggattatgatgcaatattttgaatggcatttggaagcagacggaaaa
cattgggaacggttaaaagcagatgcagaacacctaagtaaaatgggtgtgacaggtgtt
tggatcccgccttgttttaaagcaacgggcatcaatgatgtaggctatggtatttatgac
ttgtatgatttaggcgaatttgatcaaaaagacgctattcgaaccaaatatggaacgaaa
aaagaattaaaagctgcggttgatgagctacataaatatgacattcaagtttatgcggat
atcgtattgaaccataaagccggggcagatgaaacagaacgttttatggccagcgaagtg
aatccggatgatcgtaatcaaacgataagcgaaccttatgaaattgaaggatggacaaaa
tttactttcccaggcagaaaaggcacttattctgattttcagtggtcatgggtccatttt
tcaggaattgattacaatcaagagaatgggaaaaaagcaatctatcgtattgaaggcgaa
aataaaggttgggccaatgacgacaaagtaaacaacgaatatggtaattatgattattta
atgtatgcagatatcgattatgcacatccaggagtcattgaggaaactaaaaaatgggcc
aagtggttcatagaagaaacaggtgtcgatgggttccggttggatgctgtgaagcacatt
aacgagaactttatatacgatctagttaaaacgattcgaaatgaatttggcgaacaattt
tttgtggtcggtgaatactgggattcagcttatgaaagtgtagaaggttatttggaagac
caagacttcaatttggcattagttgatgtggggttgcatactaacctagaacaagcatca
aaatcaggaaatgaatacgatttatgccagctatttgatgctacattgatgaaaaaaaat
tcttcgtattcggtgacatttgtcgataaccatgattcacagcctggtcaatcgttggag
tcttttgttgaatcttggtttaaacctctggcctatggtgtcattttattgcgtgcagaa
gggtatccttgtttattttatggggattattatgggatacaaggagagaaccctatagct
ccacaacaagagatgattgataagctgttatatattcggactcatcatgcttatggcgag
caagtcgattactttgatcaccctaattgtattggctggacgcgtttagggaatgaacaa
cacccttatggctgcgcagtggtgctgtcaaatggagaagcaggttataaagagatgcag
atgggcaaacaacatgccggggaaaccttcgcggattatactggaaatcatgaagaaaaa
gtagttattgatgaaaacgggaatgggtattttttagtccaagccggatcgatttccgtt
tgggcaaaagaaggcgtaaagccagaagaagcagcggaagaaaagtaa

DBGET integrated database retrieval system