KEGG   Carnobacterium sp. CP1: NY10_1958Help
Entry
NY10_1958         CDS       T04230                                 

Definition
(GenBank) Beta-glucosidase
  KO
K01223  6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
carc  Carnobacterium sp. CP1
Pathway
carc00010  Glycolysis / Gluconeogenesis
carc00500  Starch and sucrose metabolism
Brite
KEGG Orthology (KO) [BR:carc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    NY10_1958
   00500 Starch and sucrose metabolism
    NY10_1958
Enzymes [BR:carc01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.86  6-phospho-beta-glucosidase
     NY10_1958
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_1 Cellulase Glyco_hydro_10
Motif
Other DBs
NCBI-ProteinID: ALV22547
UniProt: A0A0U3P4L1
LinkDB All DBs
Position
2028740..2030161
Genome map
AA seq 473 aa AA seqDB search
MTQEQFPDGFLWGGAVAANQLEGAYNADGKGWSVQDVTPHGGFGPITDEPTEDNMKLVGI
DFYHRYKEDIKLFAEMGFKTFRTSIAWSRIFPKGDETEPNEAGLKFYDDLFDELLKYGIE
PLVTLSHYETPLHLSKEYDGWVNRKMIDFYENYVRTVFTRYKGKVKYWLTFNEINSILHA
PFMSGGIYTAPEELTQKDLYQAVHHELVASALATKIGHEIMPEAQIGCMVLAMPIYPLTS
NPDDMVAVMEAERKNYFFSDVHVRGAYPGYMKRYFRENNIELDFGPDDEETLKNTVDFIS
FSYYMSVTETADESKRKPGKGNILGGIPNPYLEASEWGWQIDPKGLRIVLNDFWDRYQKP
LFIVENGLGANDELITDENGDKTVNDDYRIDYLNDHLVQVGEAIKDGVNVMGYTTWGCID
LVSASTAELKKRYGFIYVDRHDDGTGTLERYKKKSFYWYKQVIETNGASLTEK
NT seq 1422 nt NT seq  +upstreamnt  +downstreamnt
ttgacacaagaacaatttccagatggttttttatggggtggagcggttgcagcgaaccaa
ttagaaggtgcttataacgcagacggaaaaggatggtctgtccaagatgttacgcctcat
ggcggattcggtccgataaccgacgaaccgacagaagacaatatgaagttagtcggaatc
gatttttatcaccgttataaagaagacatcaagttatttgcggagatgggtttcaaaaca
ttccgtacatcaattgcttggtcacgtattttccctaaaggcgatgaaactgagccaaat
gaagctggtttgaaattctatgatgatttatttgatgaattgttgaaatacggcattgag
cctttagtgactctttctcactatgaaaccccactgcatttatctaaagaatatgacggc
tgggtaaaccgtaaaatgattgatttttacgaaaattacgtacggacagtcttcacccgt
tataaaggaaaagtaaaatattggctgacattcaatgaaatcaactctattttacatgca
ccatttatgagcggcggtatttatacagcccctgaagagctgacgcaaaaagacttgtat
caagcagtacaccatgagttagtagcgagtgcgttagcaacaaaaataggacatgaaatc
atgccggaagctcaaatcggttgtatggtattggcgatgccgatttatccgctaacatct
aatcctgatgatatggttgcggttatggaagctgaacgcaaaaactatttcttctcggat
gtccacgtgcgaggagcgtacccaggctatatgaaacgctacttccgtgagaacaatatt
gaacttgattttggtccagacgacgaagaaacccttaaaaatactgtggacttcatttca
ttcagttattatatgagtgtcacggaaacagctgatgagagcaaacgtaagcctggtaaa
ggcaatattttaggcggcataccaaatccgtacttagaagcctctgaatggggttggcaa
attgatccaaaaggactacgaatcgtattgaatgacttttgggatcgataccaaaaacca
ctcttcattgtcgaaaatggattaggtgctaatgacgaattgatcactgatgaaaatggc
gacaagaccgttaatgatgattaccgaatcgattatttaaacgatcacctagttcaagta
ggagaagcaatcaaagacggtgtcaatgtaatggggtacactacttggggctgtattgac
cttgttagtgcttcaacggctgaattgaaaaaacgctatggttttatctatgtggaccgt
catgacgatggcacaggtacattagaacgctataaaaagaaaagcttttattggtacaaa
caagtcatcgaaactaatggagctagtcttactgaaaaataa

DBGET integrated database retrieval system