KEGG   Carnobacterium sp. CP1: NY10_501Help
Entry
NY10_501          CDS       T04230                                 

Definition
(GenBank) 3-dehydroquinate synthase
  KO
K01735  3-dehydroquinate synthase [EC:4.2.3.4]
Organism
carc  Carnobacterium sp. CP1
Pathway
carc00400  Phenylalanine, tyrosine and tryptophan biosynthesis
carc01100  Metabolic pathways
carc01110  Biosynthesis of secondary metabolites
carc01130  Biosynthesis of antibiotics
carc01230  Biosynthesis of amino acids
Module
carc_M00022  Shikimate pathway, phosphoenolpyruvate + erythrose-4P => chorismate
Brite
KEGG Orthology (KO) [BR:carc00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    NY10_501
Enzymes [BR:carc01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.4  3-dehydroquinate synthase
     NY10_501
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DHQ_synthase Fe-ADH_2 Fe-ADH
Motif
Other DBs
NCBI-ProteinID: ALV21119
UniProt: A0A0U3MKU4
LinkDB All DBs
Position
439663..440718
Genome map
AA seq 351 aa AA seqDB search
MAELVVDLKEQSYPLKIRKGLLNDVGLEITRFYHGKKVAIITDQTVARYYEKQVKEGLLK
EGYEVVVIALPPGEESKSLNQLPFLYKALIDFGLTRSDLIVALGGGVVGDVGGFSAATFL
RGIPFVQIPTTLLAQVDSSIGGKVAVDLPEGKNLVGSFYHPVLVLIDPLVLETLSDRFFY
DGMAEVIKYACILDVDFFAFLKTLKTRAEMTKQIEQIIYTCCSLKKAIVESDERDTAERM
LLNFGHTLGHALETFYAYKKYTHGEAVAIGMYQITLLAEEKGLSAIGTAETIKSLLIQYH
LPYTLEHKDYAAVLEYVALDKKNINGVLKVVLLKTIGKSYLEETTATFFVN
NT seq 1056 nt NT seq  +upstreamnt  +downstreamnt
atggcagaattagtagtcgatttaaaagaacagagctatccattaaaaattcgcaaagga
ctcttaaatgacgttggtttagaaatcactcgtttctaccatgggaaaaaagtagccatc
ataaccgatcaaaccgttgcacgttattatgaaaagcaagtaaaggagggtctgttgaaa
gagggatacgaggttgtggtgattgcccttcctccaggagaagaatctaaatctttgaat
cagctgccatttttgtataaagcattaatcgattttggattaacgagaagcgatttaatt
gtagcgctgggaggcggagttgttggggatgttggaggattttccgctgccactttttta
agaggaatcccatttgttcaaatcccgacgactttactggcacaggttgacagcagcatc
ggcggaaaagttgctgttgatttgccagaaggaaaaaatttggtaggcagcttttaccat
cctgtattagttttgatcgacccgcttgttttggaaacgttaagcgatcgtttcttttac
gatgggatggcagaagtcattaagtatgcttgtatcctagacgttgatttctttgctttt
ttaaaaacgctaaagactagagcagagatgacaaaacaaatcgaacaaattatttatacg
tgttgttctctaaaaaaagcaatcgttgaatcagacgaaagagatactgctgaacgaatg
ttgttaaattttggtcatacccttggtcatgctttggaaacattttacgcttataaaaag
tacactcacggggaagctgttgccattgggatgtatcaaatcacattgcttgccgaagaa
aaaggattatcggctattggcacagctgaaacgatcaaatcgcttttgatccaatatcat
ttgccctacaccttagaacacaaagattatgcagcagtattggagtatgtagcacttgat
aaaaagaatataaacggggttttaaaagttgttttattaaaaactattggaaaatcgtat
ttggaagaaacaaccgccacattttttgtgaattaa

DBGET integrated database retrieval system