KEGG   Collimonas arenae: LT85_0042Help
Entry
LT85_0042         CDS       T03512                                 

Definition
(GenBank) Glutathione S-transferase
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
care  Collimonas arenae
Pathway
care00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:care00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    LT85_0042
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:care02000]
    LT85_0042
Enzymes [BR:care01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     LT85_0042
Transporters [BR:care02000]
 Other Transporters
  Pores ion channels [TC:1]
   LT85_0042
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_C GST_C_2 GST_N GST_C_3 GST_N_3 GST_N_2 Glutaredoxin2_C GST_C_6
Motif
Other DBs
NCBI-ProteinID: AIY39202
UniProt: A0A0A1F8K4
LinkDB All DBs
Position
complement(57482..58087)
Genome map
AA seq 201 aa AA seqDB search
MKLYFAPATCSLSPHIVLRELGLPFELVKVDNKTKKTADGGDFLAINPKGYVAALQLDNG
AVLTEGPAIVQYLADLKPEAKLAPPNGSWERIRLQEALNFISSEIHAGMSPLFNAAIPAE
VKAIFRDKLLKRLGQIDATLAQQDYLLGAQFSVADAYLFTVLRWAVFFSIDLAQWPAIAG
YMERIGSRESVKAALAAEALA
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atgaaattgtattttgcccccgctacctgttcgctctcgccgcacatcgtgctgcgcgaa
ctgggcctgccgtttgaactggtcaaggtcgacaacaagaccaagaaaaccgccgatggc
ggcgacttcctggcgatcaatccgaaaggctatgtggcggcattgcagctggataacggc
gcggtgctgacggaaggtcctgcgatagtccaatacctggccgacctcaagccggaagca
aaactggcgccgccgaacggcagttgggaacgcatacgcctgcaggaagcgctgaatttc
atcagcagcgaaatccacgcggggatgagcccgctattcaatgcggcgattcccgcagag
gtcaaagccatcttcagggacaagctgctcaagcggttggggcagatagacgccacactg
gcgcaacaggattacctgctcggcgcgcaattcagcgtggccgacgcctatctgttcacg
gtgctgcgctgggcggtgtttttttcgatcgatcttgcgcaatggccggccatcgccggc
tatatggagcgcatcggttcgcgcgagtcggtaaaggcggcgctggctgcggaagccctg
gcataa

DBGET integrated database retrieval system