KEGG   Collimonas arenae: LT85_0551Help
Entry
LT85_0551         CDS       T03512                                 

Definition
(GenBank) Glutathione S-transferase
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
care  Collimonas arenae
Pathway
care00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:care00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    LT85_0551
Enzymes [BR:care01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     LT85_0551
Transporters [BR:care02000]
 Other Transporters
  Pores ion channels [TC:1]
   LT85_0551
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N GST_N_3 GST_N_2 GST_C GST_C_3 GST_C_2 GST_N_4 Tom37
Motif
Other DBs
NCBI-ProteinID: AIY39711
UniProt: A0A0A1F5B1
LinkDB All DBs
Position
635498..636169
Genome map
AA seq 223 aa AA seqDB search
MIIVHHLNNSRSQRVLWLLEELGLAYEIKSYQRDPKTMLAPPSLKAIHPLGKSPVITDGD
NTIAESGAIIEYLVQKYGYGRLIPAADSKDRLRYTYWLHYAEGSAMPPLLMKLIFGRLGH
PPMPALLRPVARMIAKGVQRSYIDPQLKSHMDFMEGELGKSTWFAGEAFSAADIQISFPL
EAFQSRGGLDASRPRLLDFLQRIHARPAYQRAIERGGKYDLLK
NT seq 672 nt NT seq  +upstreamnt  +downstreamnt
atgataattgtccatcacctcaacaattcccgttcacagcgcgtgctgtggttgctcgaa
gagctggggctggcctatgaaatcaagtcttaccagcgcgaccccaaaaccatgctggcg
ccgccgtcgctaaaggcgattcatccgctgggtaaatcgccggtgattacggatggcgac
aacacgattgccgaatccggcgcgattatcgaatacctggtgcagaagtatggctatggc
cgcctgattccggccgccgacagcaaggaccgcttgcgctatacctattggctgcactac
gccgaaggctcggccatgccgccgttgctgatgaagctgatcttcggccgtcttggacat
cctccaatgccagcgctgctgcgacctgttgcgcgcatgattgcaaagggcgtacagcgc
agctacatcgatccgcagctgaagtcgcatatggatttcatggaaggcgagctgggcaaa
tccacctggttcgcaggcgaagcattcagcgccgccgacatccagatcagttttccgctg
gaagcatttcaatcgcgtggcggcctcgacgccagccggccacgtctgctcgatttcttg
cagcggatccatgcacgtccagcctatcagcgtgcgattgaaagaggcggcaagtacgat
ttgttgaaatag

DBGET integrated database retrieval system