KEGG   Collimonas arenae: LT85_0828Help
Entry
LT85_0828         CDS       T03512                                 

Definition
(GenBank) Aerobic glycerol-3-phosphate dehydrogenase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
care  Collimonas arenae
Pathway
care00564  Glycerophospholipid metabolism
care01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:care00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    LT85_0828
Enzymes [BR:care01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     LT85_0828
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_binding_3 FAD_oxidored Pyr_redox_2 FAD_binding_2 3HCDH_N NAD_binding_8
Motif
Other DBs
NCBI-ProteinID: AIY39988
UniProt: A0A0A1F5J1
LinkDB All DBs
Position
937835..939367
Genome map
AA seq 510 aa AA seqDB search
MASGEIVDLLVVGGGVNGAGIARDAAGRGLSVLLCEQDDLASHTSSASTKLIHGGLRYLE
HYEFSLVRKALQERELLLRLAPHIIAPLRFVMPHVSSLRPAWMIRAGLFLYDHLSKRELL
PGSRTIDFRKHVAGAPLKKTISKGFVYSDAAVQDARLVVLNAMDARERGATILTKTRLIQ
AKQGAQYWDATLQSTQTGETTEIKARCVVNAAGPWVASLLNGALNTPAQHHIRLVKGSHI
VTKRLFDHDHAYIFQNPDKRIVFAIPYEKDFTLIGTTDVEFSANPGKVEISEEETAYLCE
SVSRYFEVAVTPRQVVWSYAGVRPLLEEEVANPSAVTRDYKLELRNEAGLAPVLSVFGGK
ITTYRRLAEEVMEHLQPLFGYMKSHWTAHEPLPGGDIPNANFTEFHRIFQQRHAWLPATL
AARYAGAYGTRSARLLEGIHDVTGLGELFGADLYEAEVRYLIREEWALTVEDILWRRSKL
GLRLDAVAVERLRTWLQEQEQAQPVVAMRA
NT seq 1533 nt NT seq  +upstreamnt  +downstreamnt
gtggcatcaggtgaaattgtagatttgctggtagtgggcggcggcgttaacggcgccggg
attgcgcgcgacgcagcgggccgcggcctgagcgtgttactttgcgaacaggatgacctg
gcttcgcatacctcatcggccagcaccaaactgatccatggcggcttgcgctatctcgag
cattacgaattcagcctggtgcgcaaagcgttgcaagagcgcgaattgttgctgcgcctg
gcgccacatatcattgcgccgctgcgcttcgtgatgccgcatgtatcgagcctgcggccg
gcctggatgatacgcgccggcctgttcctgtacgatcacctcagcaagcgcgaattgctt
cccggttcccgcaccatcgatttccgtaagcacgtcgccggcgcgccgctcaagaaaacc
atcagcaagggcttcgtctattccgacgctgccgtgcaagatgcccgcctggtggttctg
aacgccatggatgccagggagcgcggcgccaccattcttactaaaacccgtttgatccag
gctaagcaaggcgcacagtattgggacgccaccttgcagtcgacccaaaccggcgagacc
accgagatcaaggcgcgctgtgtcgtcaatgctgccggcccgtgggttgccagcctgttg
aacggcgccttgaatacgccggcgcagcatcatatccggctggtcaagggaagccatatc
gtgaccaagcgtttgttcgatcacgatcacgcctatattttccagaatcccgacaaacgc
atcgtttttgccattccatacgaaaaagacttcacgctgatcggcaccactgatgtcgag
ttcagcgccaatccgggtaaggtcgagatttccgaagaggaaaccgcttatctgtgcgag
tcggtgagccgctatttcgaagtcgccgtgacgccccggcaagtggtctggtcgtatgcc
ggcgttcgccctttgctcgaagaggaagtggccaatccctccgccgtgacgcgtgactac
aaacttgagctgcgtaacgaagcgggcctggcgccagtgttgtcggtgttcggcggaaag
atcactacttaccggcgcttggcggaagaagtcatggagcatttacagccattgttcggc
tacatgaaatcgcactggaccgcgcatgaaccgctgccgggcggcgatattccgaacgcg
aatttcacagagttccacaggattttccagcaacgccacgcatggctgccggctaccctg
gcggcgcgttacgccggtgcttacggcacacgctctgcgcgcttgcttgagggaattcac
gacgttaccggattaggcgagctgttcggcgcagacctgtacgaagcggaagtgcgctat
ctgattcgcgaagaatgggcgctgacggttgaagatattctgtggcgtcgttccaagctg
ggattgcgtctcgatgctgtagcggtagaaagactgcggacctggttgcaagagcaggag
caagcgcaaccggtagttgcaatgcgtgcttaa

DBGET integrated database retrieval system