KEGG   Collimonas arenae: LT85_3029Help
Entry
LT85_3029         CDS       T03512                                 

Definition
(GenBank) Xylitol dehydrogenase
  KO
K05351  D-xylulose reductase [EC:1.1.1.9]
Organism
care  Collimonas arenae
Pathway
care00040  Pentose and glucuronate interconversions
care01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:care00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    LT85_3029
Enzymes [BR:care01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.9  D-xylulose reductase
     LT85_3029
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_zinc_N_2 Shikimate_DH
Motif
Other DBs
NCBI-ProteinID: AIY42187
UniProt: A0A0A1FH26
LinkDB All DBs
Position
complement(3403285..3404334)
Genome map
AA seq 349 aa AA seqDB search
MMEYMMKALVLEKQHDIQLREIELPLVVGPRDVKIKIHTVGVCGSDVHYYQHGNIGSFVV
NKPMVLGHEAAGVVVEAGADVTSLKVGDRVCMEPGVPDFESKATRLGLYNLDPAVSFWAT
PPVHGCLTPFVSHPAAFTFKLPDNVSFAEGAIVEPLSIGLQAATKAQIKPGDMAVVLGAG
TIGMMTALAALAGGCSRVVICDLVQEKLDLIHTYPGITTVNLRKQSLLEVVTDLSGEWGA
DIVFEASGSEKAYDGIFDLLCPGGCLVLVGMPANTVAIDIVAIQAKEIRIESVFRYANIF
PRALALIASGKINVKPFISRSFKFSDGVAAFEAAASGNPHDVKIQIELE
NT seq 1050 nt NT seq  +upstreamnt  +downstreamnt
atgatggagtacatgatgaaagccctggttctcgaaaagcaacatgacatccagttgcgg
gagattgagctgccgctggtggtcggcccgcgcgatgtcaagatcaagattcacacagtg
ggcgtttgcggtagcgatgtgcattactaccagcatggcaatatcggctcgttcgttgtg
aataagccgatggtgctgggccatgaagcggctggcgtggtggtagaagcgggagccgat
gtgacttccctgaaggtcggggaccgcgtttgcatggagcctggcgttccggattttgaa
tccaaggcaacgcgcctgggtttgtataacctcgatccggccgtgagtttctgggcgacg
ccgcctgtccatggttgtctgacgccgttcgtctcgcatcccgcagcctttaccttcaaa
ctgccggacaacgtcagttttgccgagggcgcaatcgtcgaaccgttgtcgatcggcctg
caggcagcgaccaaggcgcaaatcaagccgggcgacatggcagtggtgctgggtgccggc
accatcggcatgatgactgcgctggcagcgctggccggcggttgcagccgggtagtgatt
tgcgatctggtgcaggaaaaattggatttgatccatacatatcctggcatcaccaccgtt
aacctgcgcaagcaatctttattggaagtcgtcactgatcttagcggggagtggggggcg
gatatcgtttttgaagccagtggcagcgagaaggcctacgacggcatctttgatctgttg
tgtccgggtggttgcctggtgctggtcggtatgccggcgaacaccgtggcaatcgatatc
gtagcgatccaggccaaggaaatccgtatcgaatcggttttccgctacgccaatatcttc
ccgcgtgcgttagccctgatcgcttccggaaagatcaatgtcaagccgtttatttcacgc
tcgttcaagttttccgacggcgtcgctgccttcgaggccgccgccagcggcaatccgcac
gatgtcaagatccagatcgaattggagtaa

DBGET integrated database retrieval system