KEGG   Collimonas arenae: LT85_3358Help
Entry
LT85_3358         CDS       T03512                                 

Definition
(GenBank) Phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
care  Collimonas arenae
Pathway
care00620  Pyruvate metabolism
care00680  Methane metabolism
care01100  Metabolic pathways
care01120  Microbial metabolism in diverse environments
care01200  Carbon metabolism
Module
care_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:care00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    LT85_3358
  Energy metabolism
   00680 Methane metabolism
    LT85_3358
Enzymes [BR:care01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     LT85_3358
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2
Motif
Other DBs
NCBI-ProteinID: AIY42516
UniProt: A0A0A1FDB0
LinkDB All DBs
Position
3787994..3790867
Genome map
AA seq 957 aa AA seqDB search
MAKQLNSAVQVKKYTPNKDAPLKEDIRLLGRLLGDVLREQEGDAVFEVVETIRQTAVRFR
RESDPQAGADLDKLLKKLTRDQTNSVVRAFSYFSHLANIAEDQHHNRRRRAHLLAGSTPQ
AGSVAHALSKLDDAGVSGATVRNFLKDALISPVLTAHPTEVQRKSILDAEREIARLLAER
DLPLTAKELRDNTELLRGRIATLWQTRMLRYTKLTVADEIENALSYYRITFLRELPALYD
DIEGEIATQFPTRGRQASTELAPFVQMGSWIGGDRDGNPNVNASTMQRALTRQSTTIFDF
YLEEVHALGAELSVSTLMVSVNQELLTLAEKSPDTSDHRSDEPYRRALIGIYARLASTAR
ELGATNILRQEVGAAAHYATPQEFTGELQIVEDSLRAHHGSALIKPRLATLKRASEIFGF
HLASLDMRQSSDVHERVLTELFAQAQVETAYDQLNEDQKIALLLAELAKPRLLYSPYIAY
SDETVSELSILRAAGEMRQRYGARSIRNYIISHTETVSDLLEVLLLQQETGLLRPDAKDS
KAGKDAGALEVMVIPLFETIPDLRRAAAIMEQFMALPPVERLIAKHGKLQEVMLGYSDSN
KDGGFLTSNWELYKAEIQLVRVFDRAGVKLRLFHGRGGTVGRGGGPSYQAILAQPPGTVN
GQIRLTEQGEIIASKFSNPEIGRRNLELLVAATLEASLMPNTADGKQMKKLGEFEELMDG
LSERAYQSYRNLVYETPGFTDYFFSATPIAEIAELNIGSRPASRKSTRRIEDLRAIPWGF
SWGQCRLLLPGWYGFGSAIESWLEEGNDGGKDAKLKSQKLATLRAMYKEWPFFATLLSNM
DMVLSKTDLAVASRYAGLVTDRKLRNSIFKRIVDEHERTSSILSAITGAKDRLSGNPLLA
RSIKNRFAYLDPLNHLQVELIRRHRSVTAAGRTTEERVKRGIHLSINGIAAGLRNTG
NT seq 2874 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaacaattgaattctgctgtccaggtaaaaaaatacactcccaacaaagatgcg
ccgctcaaggaagatatccgtctgctgggccgcttgctgggcgacgtgttgcgtgagcaa
gagggcgatgccgtatttgaagttgtggaaaccatccgccagacagcagtgcgtttccgg
cgcgagtcagacccgcaagccggcgccgatctcgacaagttattgaaaaaactgacccgc
gaccagaccaattccgtggtgcgggcattttcctatttttcgcatctggccaatatcgcc
gaagaccagcaccacaaccgccgccgccgcgcccacctgctggcaggctcgacgccgcaa
gccggcagcgtcgcacatgcgttaagcaagctggacgatgccggcgtctccggcgccacc
gtacgcaactttctcaaggatgcgctgatttcgccggtgttgaccgctcacccgaccgaa
gtgcagcgcaagagtatcctcgatgcagagcgtgaaatcgcccgcctgctggccgaacgt
gaccttccgctgaccgccaaggaattgcgcgacaacaccgagctgctgcgaggccgtatc
gccactttgtggcaaacccgcatgctgcgctataccaagctgaccgtcgccgacgaaatc
gagaatgcgttgtcttactatcgcatcactttcctgcgtgagttgcctgcgctgtacgac
gacatcgaaggcgaaatcgcgactcagttccctactcgtggccgccaagccagtaccgag
ctggcgccgttcgtgcagatgggtagctggatcggcggcgaccgcgacggcaatcctaat
gtgaacgccagcaccatgcaacgcgcgctgacgcggcaatcgaccaccattttcgatttc
tacctggaagaagtgcacgccctcggcgccgagctgtcggtctcaaccctgatggtgagc
gtcaaccaggaattgctgacgctggcggaaaaatcgccggatacttctgaccaccgttcc
gacgaaccttaccgccgcgccttgatcggtatctacgctcgcctggcatcgactgcgcgc
gaactcggcgccaccaatatcctgcgccaggaagtcggcgccgcggcacactatgcaacg
ccgcaggaatttaccggtgaactacagatcgtcgaagactctttgcgtgcgcatcacggc
agcgcgctgatcaagccgcgtttggcgacactcaagcgcgcttccgaaattttcggcttt
cacctggcgtcgctcgacatgcgccagagttccgatgtgcacgaacgcgttctgaccgaa
ctgttcgcacaagcacaagtggaaactgcctacgaccagctgaacgaagatcagaagatc
gcgctgctgttggccgaactggccaagccgcgcctgttgtattcaccctatatcgcgtat
tccgatgaaacagtgtcggaactgtcgatcctgcgcgcagccggagaaatgcggcaacgc
tatggcgctcgctcgatccgtaactacatcatctcgcacactgaaaccgtatcggatttg
ctggaagtcttgttgctgcaacaggaaaccggcctgctgcgccctgacgccaaagacagc
aaagccggcaaggacgcaggcgctctggaagtgatggtgattccgttgttcgaaaccatt
cccgacctgcgccgcgccgctgccatcatggaacaattcatggccttgccgccggtagag
cgtctgatcgccaagcacggcaagctgcaggaagtaatgctgggttattccgactccaac
aaggacggcggcttcctgacttcgaactgggaactgtacaaagccgagatccagctggtg
cgggtattcgatcgcgccggcgtcaagctgcgcctgttccatggccgcggcggcaccgtc
ggccgcggcggtggtccaagctaccaggcgatcctggcgcaacccccaggcacggtcaac
ggccagatccgtttgaccgaacagggcgaaattatcgcttccaaattttccaatccggaa
atcggccgccgcaatctggagttattggtggccgccacgctggaagccagcctgatgccg
aataccgccgacggcaagcagatgaagaagctgggtgagttcgaggaattgatggatggc
ttgtcggaacgcgcctatcagtcgtatcgcaacctggtctacgaaactccgggcttcacc
gactatttcttctcggcgaccccgattgccgagattgcggaactgaacatcggatcgcgc
cctgcttcgcgcaaatcgacgcgccgcatcgaagacttgcgggccattccatggggcttt
tcctggggccagtgccgtctgctgttgccaggctggtatggcttcggcagcgccatcgaa
agctggctggaagaaggtaacgacggaggcaaggacgccaagctgaaaagccagaagctg
gcgaccttgcgggcgatgtacaaggaatggccgttcttcgccaccctgctgtcgaacatg
gacatggtgctgtccaagaccgacctggcggtggcttcgcgctacgccgggctggtcacc
gaccgcaagctgcgcaacagcattttcaagcgcatcgtcgacgaacatgagcggaccagc
agcatcctgtcggccatcaccggcgccaaggatcgcttgtcgggcaatccgttgctggcc
cgctccatcaagaatcgcttcgcctatctcgatccgctgaatcacttgcaagtcgaactg
atcaggcgtcaccgcagcgttaccgcggctggccgcacgacagaggaacgagtaaaacgc
ggtatccatttgagcatcaatggcattgctgccggcttgcgtaataccggctga

DBGET integrated database retrieval system