KEGG   Clostridium argentinense: RSJ17_03050Help
Entry
RSJ17_03050       CDS       T05123                                 

Definition
(GenBank) aldehyde dehydrogenase
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
carg  Clostridium argentinense
Pathway
carg00010  Glycolysis / Gluconeogenesis
carg00071  Fatty acid degradation
carg00280  Valine, leucine and isoleucine degradation
carg00310  Lysine degradation
carg00330  Arginine and proline metabolism
carg00340  Histidine metabolism
carg00380  Tryptophan metabolism
carg00410  beta-Alanine metabolism
carg00561  Glycerolipid metabolism
carg00620  Pyruvate metabolism
carg00625  Chloroalkane and chloroalkene degradation
carg01100  Metabolic pathways
carg01110  Biosynthesis of secondary metabolites
carg01120  Microbial metabolism in diverse environments
carg01130  Biosynthesis of antibiotics
Module
carg_M00135  GABA biosynthesis, eukaryotes, putrescine => GABA
Brite
KEGG Orthology (KO) [BR:carg00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    RSJ17_03050
   00053 Ascorbate and aldarate metabolism
    RSJ17_03050
   00620 Pyruvate metabolism
    RSJ17_03050
  Lipid metabolism
   00071 Fatty acid degradation
    RSJ17_03050
   00561 Glycerolipid metabolism
    RSJ17_03050
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    RSJ17_03050
   00310 Lysine degradation
    RSJ17_03050
   00330 Arginine and proline metabolism
    RSJ17_03050
   00340 Histidine metabolism
    RSJ17_03050
   00380 Tryptophan metabolism
    RSJ17_03050
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    RSJ17_03050
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    RSJ17_03050
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    RSJ17_03050
Enzymes [BR:carg01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     RSJ17_03050
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh LuxC
Motif
Other DBs
NCBI-ProteinID: ARC83589
LinkDB All DBs
Position
527978..529348
Genome map
AA seq 456 aa AA seqDB search
MRDIKDLVDIQRKYFYTGETLSIDFRFKQLTLLKDIITKNEEKILEALNKDLNKANFEGY
ATELGIVLEEINYTIKNLKKWSQPTKVKSQIAHFPASCFSYPEPYGVTLVISPWNYPFQL
SIAPMIGAIAGGNTVILKPSNKSVHVSKILTELIEQNFKEEYIAVVNGGREENTELLNQK
FDYIFFTGSVPVGRIVMEAAAKNLTPTTLELGGKSPCIVDYDADIKVTARRIVWGKFLNA
GQTCVAPDYIYVHKDVKDALIDSMIYYVKKFYGENPKESNDYPRIIDTGQFDRLIGYLDE
GNIEIGGRFEREELYISPTILNNVTFDDSVMKDEIFGPIMPILEFNSLDEAIDMVNSRPK
PLALYFFSKNEKSIEKVLTYTSSGGVCINETIMHVASLYLPFGGVGDSGMGKYHGRASFD
TFTHHKSVVKKGFSIDVPLRYPPYNDKIKYIKKIFK
NT seq 1371 nt NT seq  +upstreamnt  +downstreamnt
atgagagatataaaagaccttgtagatattcaaaggaaatatttctataccggagaaacc
ttaagtatagactttagatttaagcaattgacacttttaaaagatataataactaaaaac
gaagaaaagatattagaagcattaaataaggacttaaataaggcaaattttgaaggatat
gcaacagagttgggcatagtattagaagaaattaattatacaataaaaaatttaaaaaaa
tggtcacagcccacaaaagttaaatcacaaatagctcattttcctgcaagttgtttttct
tatcctgagccatatggagtaacacttgttatttccccatggaattatccttttcaatta
tctatagcacctatgataggggctatagcaggaggaaatacagtaatattaaaaccatct
aataaaagtgttcatgtatctaaaattttaacagaattaatagaacagaattttaaagaa
gaatatatagcagtagtaaatggtggtagagaggaaaatacagaacttttaaatcaaaaa
tttgattatattttttttacaggaagtgtacctgtaggacgtatagtaatggaggcggca
gcaaagaacctaactcctacaactttagagttaggtgggaaaagtccttgcatagtagat
tatgatgcagacataaaagtaacagctagaagaatagtttggggaaagtttttaaatgca
ggtcaaacctgtgtagcaccagattatatatatgttcacaaggatgtaaaagatgcatta
attgattctatgatttactatgttaagaaattttatggagaaaatcctaaagaatcaaat
gattatccaagaattatagatactggacaatttgatagattaataggatatttagatgag
ggaaacattgaaattggcggaagatttgagagagaagaattatatatttctcctacaata
ttaaataatgttacttttgatgatagcgttatgaaagatgaaatttttggacctataatg
cctatattggaatttaatagtttagatgaagcaatagatatggttaatagtcgtcctaag
ccattagcattatatttcttttcaaaaaatgaaaagagtatcgaaaaagtattaacttat
acctcatccggtggagtttgtataaatgagactataatgcatgtagcatcgctatatctt
ccttttggaggagtaggagacagtggaatgggaaaatatcatggaagagctagctttgat
acttttactcatcataagtcagtggttaaaaaaggattttcaattgatgttcctttaagg
tatccaccatataatgacaaaattaaatatataaagaagatatttaaataa

DBGET integrated database retrieval system