KEGG   Clostridium argentinense: RSJ17_05565Help
Entry
RSJ17_05565       CDS       T05123                                 

Definition
(GenBank) alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
carg  Clostridium argentinense
Pathway
carg00473  D-Alanine metabolism
carg01100  Metabolic pathways
carg01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:carg00001]
 Metabolism
  Metabolism of other amino acids
   00473 D-Alanine metabolism
    RSJ17_05565
 Human Diseases
  Drug resistance
   01502 Vancomycin resistance
    RSJ17_05565
Enzymes [BR:carg01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     RSJ17_05565
Peptidoglycan biosynthesis and degradation proteins [BR:carg01011]
 Precursor biosynthesis
  Racemase
   RSJ17_05565
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C
Motif
Other DBs
NCBI-ProteinID: ARC84033
LinkDB All DBs
Position
1068769..1069932
Genome map
AA seq 387 aa AA seqDB search
MFRHLRPVWAEVDLDKLAYNMREIRRISKSKNIIAVVKADGYGHGAVDIAPVLLQNGANG
LAVAVISEAVELRRAGIEAPIMVLGFTPPNLIDNLLRYDIEQTVINYEFAKELSNMARKK
NKIAKIHIAVDTGMGRIGFLPNDRSVDEIYKISQLSNIEIEGLFSHFSSADEGDKEYTKL
QVERFNDFYNKLKNLNIKINNRHIGNSAAIIDLPETHFEAVRPGIILYGYYPSNEVVKQK
IKLKPVMSLKSNIIHIKTLPPGEHISYGRRFKTERESIIATLPVGYADGYTRLLFGKARV
IVNGKFAPVVGTICMDQCMIDVTSIDGVELGNEVILIGEDDHNNKFTADNVAELLGTINY
EIVCAINKRVPRVYIKGGKVIKVRNYV
NT seq 1164 nt NT seq  +upstreamnt  +downstreamnt
ttgtttagacatttaagaccagtatgggcagaagtagacttagataaactagcttataat
atgagagaaataaggagaatttctaaaagtaaaaatattatagcagtagtaaaagcagat
ggatatggccatggagcagtggatatagcaccagtgcttttacaaaatggagccaacgga
ttagcagttgcagtaataagtgaagcagtagaattaagaagagcaggaattgaagcacca
attatggtacttggtttcacacctcctaatttaatagataatttattaagatatgatatt
gagcaaaccgtaattaactatgaatttgccaaggagctatctaatatggctcgcaagaaa
aataaaatagctaagattcatattgcagtggacacaggtatgggacgtataggattctta
ccaaatgatagaagtgttgatgaaatttataaaattagtcaattatctaacatagaaata
gaggggttattttcacatttttcatcagcggatgaaggggacaaggagtatactaaatta
caggtggaacgttttaacgacttttacaataaacttaaaaatttaaatataaaaattaat
aataggcatattggaaatagtgcagcaatcattgatttaccagaaactcattttgaggcg
gtaagaccagggattatactatatggatattatccgtcaaatgaagtagtaaaacagaaa
ataaagttaaaaccagtaatgtcattaaaatcgaatattattcatataaaaactttacca
ccaggagaacatataagttatggtagaagatttaaaacggaaagagaaagcattattgct
actcttcctgtaggatatgctgatggttatacaagattactttttggaaaagcaagggtt
attgttaatgggaaatttgcaccagtagttggtactatatgtatggatcaatgtatgata
gatgtaacaagcattgatggtgtagaacttggaaacgaggttatactaataggtgaagac
gaccataacaataaatttactgctgataatgtagcagagcttctaggtacgataaattat
gaaattgtttgtgctataaataagagagtaccaagagtttacataaaaggtggtaaagta
atcaaagttaggaattatgtataa

DBGET integrated database retrieval system