KEGG   Clostridium argentinense: RSJ17_05580Help
Entry
RSJ17_05580       CDS       T05123                                 

Definition
(GenBank) transketolase
  KO
K00615  transketolase [EC:2.2.1.1]
Organism
carg  Clostridium argentinense
Pathway
carg00030  Pentose phosphate pathway
carg01100  Metabolic pathways
carg01110  Biosynthesis of secondary metabolites
carg01120  Microbial metabolism in diverse environments
carg01130  Biosynthesis of antibiotics
carg01200  Carbon metabolism
carg01230  Biosynthesis of amino acids
Module
carg_M00007  Pentose phosphate pathway, non-oxidative phase, fructose 6P => ribose 5P
Brite
KEGG Orthology (KO) [BR:carg00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    RSJ17_05580
  09109 Metabolism of terpenoids and polyketides
   01051 Biosynthesis of ansamycins
    RSJ17_05580
Enzymes [BR:carg01000]
 2. Transferases
  2.2  Transferring aldehyde or ketonic groups
   2.2.1  Transketolases and transaldolases
    2.2.1.1  transketolase
     RSJ17_05580
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transketolase_N DXP_synthase_N E1_dh TPP_enzyme_C XFP_N
Motif
Other DBs
NCBI-ProteinID: ARC84036
LinkDB All DBs
Position
1071115..1071942
Genome map
AA seq 275 aa AA seqDB search
MERTLDQLKDIAKEIRKDIVTMLTESASGHPGGSLSAVEILTTLYFNEMNVDPSNPKNPK
RDRFVLSKGHAAPVLYSTLVEKGFFERSELMKLRKIGSILQGHPNMNYVPGVDMSTGSLG
QGISTAVGMALAGKLDNSEYRVYTLLGDGELQEGQVWEAAMSAAHYKLENLTAFVDYNGL
QIDGDISEVMNPNPIADKFAAFGWNVIVLEDGHDLVAIKNSIEEAKKITNKPTVVVCKTI
KGKGVSFMENQAGWHGTAPNKEQCDLALKEIGGEA
NT seq 828 nt NT seq  +upstreamnt  +downstreamnt
atggaaagaacactagaccaattaaaagacattgctaaagagataagaaaagacatagtt
acaatgctaactgagtcagcttcaggacatccaggtggttcattatcagcagttgaaatt
ttaactacattatattttaatgagatgaatgtagacccaagcaatcctaaaaatccaaag
agagacagatttgtactttcaaaaggacatgcagcaccagttttatatagtacattagtt
gaaaaaggattttttgaaagatctgagcttatgaaactaagaaaaataggttcaatactt
caaggacatccaaatatgaactatgttccaggtgttgatatgtcaacaggttcattaggt
caaggtatttctacagcagtaggtatggcattagctggaaaactagataatagtgaatat
agagtatatactcttttaggcgatggagaactgcaagaaggtcaagtgtgggaagcggct
atgagtgctgcacactataagttagaaaacttaacagcctttgttgattataatggactt
caaatagatggagatatatctgaagttatgaacccaaatccaatagcggataaatttgct
gcttttggttggaatgtcatagtattagaggatggacatgatttggtggctattaaaaac
tccatagaggaagctaaaaaaataacaaataagcctacagtggtagtatgtaaaacaatt
aagggtaaaggcgtatcatttatggaaaatcaagcaggatggcatggaactgcccctaat
aaagaacaatgcgatttagcattaaaagaaataggaggggaagcataa

DBGET integrated database retrieval system