KEGG   Clostridium argentinense: RSJ17_14270Help
Entry
RSJ17_14270       CDS       T05123                                 

Definition
(GenBank) hypothetical protein
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
carg  Clostridium argentinense
Brite
Enzymes [BR:carg01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     RSJ17_14270
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-ProteinID: ARC85586
LinkDB All DBs
Position
complement(3002675..3003277)
Genome map
AA seq 200 aa AA seqDB search
MEEKLSPKTFNFKSIKGISLNQLEQHYKLYEGYVTNVNKIWSGIKEQRDFEGTNATFSPY
RSLLVAQSFALDGVKLHELYFENMNGEVKGISSGVYEAIVESFGSYNFFEELFKNAGLAV
RGWVVLAYEPIDKRLHVYGLDSHDCGPIWNAYPLLVLDVYEHAYMIDFGIDRKKYIEVFM
NNIDWRVVNDRMVALRKMLN
NT seq 603 nt NT seq  +upstreamnt  +downstreamnt
atggaggagaaattaagtcctaaaacttttaattttaaaagtattaaaggaataagctta
aatcaattagaacaacattataaattatacgaaggatatgtaacgaatgttaacaaaata
tggagtggtataaaggaacaaagggattttgaaggaacaaatgccactttcagcccttat
agaagtcttttagtagctcagagttttgcattagatggggttaagcttcatgaactttat
tttgaaaatatgaatggagaagtgaagggtatatcctcaggtgtttatgaagctatagtt
gaaagttttggtagctataacttttttgaagaattatttaaaaatgcaggattagcagtt
agaggatgggtagtacttgcatatgaacctatagataaaagacttcatgtatatggactt
gatagtcatgattgtggacctatatggaatgcttatccattacttgttttagatgtttat
gagcatgcatatatgattgattttggaattgatagaaagaaatatattgaagtttttatg
aataatattgattggagagttgtgaatgataggatggttgcattaagaaaaatgttgaat
taa

DBGET integrated database retrieval system