KEGG   Clostridium argentinense: RSJ17_15185Help
Entry
RSJ17_15185       CDS       T05123                                 

Definition
(GenBank) triose-phosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
carg  Clostridium argentinense
Pathway
carg00010  Glycolysis / Gluconeogenesis
carg00051  Fructose and mannose metabolism
carg00562  Inositol phosphate metabolism
carg01100  Metabolic pathways
carg01110  Biosynthesis of secondary metabolites
carg01120  Microbial metabolism in diverse environments
carg01130  Biosynthesis of antibiotics
carg01200  Carbon metabolism
carg01230  Biosynthesis of amino acids
Module
carg_M00002  Glycolysis, core module involving three-carbon compounds
carg_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:carg00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    RSJ17_15185
   00051 Fructose and mannose metabolism
    RSJ17_15185
   00562 Inositol phosphate metabolism
    RSJ17_15185
Enzymes [BR:carg01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     RSJ17_15185
Exosome [BR:carg04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   RSJ17_15185
  Exosomal proteins of bladder cancer cells
   RSJ17_15185
  Exosomal proteins of melanoma cells
   RSJ17_15185
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: ARC85739
LinkDB All DBs
Position
complement(3163793..3164539)
Genome map
AA seq 248 aa AA seqDB search
MRKAIIAGNWKMHKTVSEATALVEELKPLVKGAACDVVVCPTSICLPAVVEAVKGTNIKV
GAQNMHFEESGAFTGEISPIMLKDLGVEYVIIGHSERRQYFNETDETVNKKLKSAFAHGL
IPILCIGESLEEREGNITEEVLAKQVKLDLNGITSENVKGMIVAYEPIWAIGTGKTATAD
DANETIGFIRKVIEKLYGNEVSEAVRIQYGGSVKPSTIKEQMEKEHIDGGLIGGASLKAQ
DFSAIVNY
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
atgagaaaagcaataattgcaggtaactggaaaatgcataaaactgtaagtgaagctaca
gctttagtagaagaattaaaaccattagttaagggagcagcttgtgacgtagttgtgtgt
ccaacttctatatgtttaccagcagtagtagaagcagttaagggaactaatataaaagta
ggggcgcaaaatatgcattttgaagaaagcggtgcttttacaggagaaatttcaccaata
atgcttaaggatttaggtgttgaatatgtaattataggtcatagtgaaagaagacagtat
tttaatgaaactgatgaaactgttaataaaaagttaaaatctgcttttgctcatgggttg
attccaatattatgcattggtgaatcattagaagaaagagaaggtaatatcacagaagag
gtattagctaaacaagttaaattagatttaaatggaattacatcagagaatgttaaggga
atgattgtagcttatgagccaatttgggctataggaactggaaagacagctacagcagat
gatgctaatgaaacaattggttttataagaaaagtaatagagaaattatatggcaatgaa
gtaagtgaagctgtaagaattcaatatggtggttctgtaaaaccttctactattaaagaa
caaatggaaaaagaacatatagatggagggttaattggaggtgctagtctaaaagcacag
gattttagtgccattgtaaattattaa

DBGET integrated database retrieval system