KEGG   Clostridium argentinense: RSJ17_19860Help
Entry
RSJ17_19860       CDS       T05123                                 

Definition
(GenBank) acyl-CoA dehydrogenase
  KO
K00248  butyryl-CoA dehydrogenase [EC:1.3.8.1]
Organism
carg  Clostridium argentinense
Pathway
carg00071  Fatty acid degradation
carg00280  Valine, leucine and isoleucine degradation
carg00410  beta-Alanine metabolism
carg00640  Propanoate metabolism
carg00650  Butanoate metabolism
carg01100  Metabolic pathways
carg01110  Biosynthesis of secondary metabolites
carg01120  Microbial metabolism in diverse environments
carg01130  Biosynthesis of antibiotics
carg01200  Carbon metabolism
carg01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:carg00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    RSJ17_19860
   00650 Butanoate metabolism
    RSJ17_19860
  09103 Lipid metabolism
   00071 Fatty acid degradation
    RSJ17_19860
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    RSJ17_19860
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    RSJ17_19860
Enzymes [BR:carg01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.8  With a flavin as acceptor
    1.3.8.1  short-chain acyl-CoA dehydrogenase
     RSJ17_19860
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Acyl-CoA_dh_1 Acyl-CoA_dh_N Acyl-CoA_dh_2 Acyl-CoA_dh_M
Motif
Other DBs
NCBI-ProteinID: ARC86582
LinkDB All DBs
Position
complement(4243238..4244377)
Genome map
AA seq 379 aa AA seqDB search
MNFSLTKEQEFVKQMVREFAENEVKPIAAEIDVTERFPMENVEKMARYHMMGIPFSTEFG
GAGGDSISYAITVEELSRVCGTTGVIVSAHTSLCAAPIDAFGTPAQKEKYLVPLAKGEKI
GAFGLTEPNAGTDASGQQTTAYLDGDNYILNGSKIFITNGGVADTFVVFAMTDKSQGTRG
ISAFIVEKDFPGFSIGKVEEKLGIRASSTTELVFENCVVPKENLLGKEGKGFGIAMKTLD
GGRIGIAAQALGIAQGALDEAVAYMKERKQFGKPLAAFQGLQWMVAEMDVKVEAARQLVY
KAAYRKDNKLPYTVDAARAKLFASEVAMEVTTKAVQIFGGYGYTKEYPVERMMRDAKITE
IYEGTSEVQRMVIAGNILK
NT seq 1140 nt NT seq  +upstreamnt  +downstreamnt
atgaatttttctttaactaaggaacaagaatttgtaaaacaaatggtaagggaattcgct
gaaaatgaagtgaagcctattgccgctgaaatagatgtaactgaaagatttccaatggaa
aatgtagaaaaaatggctagataccatatgatgggaatccctttttctactgaattcggt
ggagcaggtggagatagcatatcttatgctataacagtagaagaattatcaagagtttgc
ggaactacaggagttatagtttcagctcatacttcattatgtgctgctccaatagatgct
tttggaactccagctcaaaaagaaaagtacttagtgccattagctaaaggagaaaaaatc
ggtgcattcggtttaactgagcctaatgcaggaacagatgcttctggacaacaaacaaca
gcttacttagatggagataactatatattaaatggttcaaaaatattcatcactaacggt
ggagttgctgatacttttgtagtatttgctatgactgataaatctcaaggaacaagagga
atatcagcatttatagttgaaaaagatttcccaggattctcaataggtaaagttgaggaa
aaactaggaataagagcttcttcaacaactgagcttgtatttgaaaactgtgtagttcca
aaagagaacttactaggaaaagaaggaaaaggctttggtatagcaatgaaaactcttgat
ggaggaagaattggtatagctgctcaagcattaggaatagctcaaggtgctttagatgaa
gctgttgcatatatgaaagaaagaaaacaatttggaaaaccacttgcagcgttccaagga
ttacaatggatggttgctgaaatggacgttaaagttgaagctgctagacaattagtttac
aaagctgcttacagaaaagataataaattaccatatacagtagatgctgcaagagctaaa
ttatttgcatcagaagtagctatggaagttactactaaagctgttcaaatatttggtgga
tatggttacactaaagagtatccagttgaaagaatgatgagagatgctaagataactgag
atttacgaaggaacttctgaagttcaaagaatggttatcgcaggaaacatcttaaagtag

DBGET integrated database retrieval system